BLASTX nr result
ID: Atractylodes21_contig00046072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046072 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT39305.2| Dof domain, zinc finger family protein [Solanum d... 63 2e-08 ref|XP_003539737.1| PREDICTED: dof zinc finger protein DOF2.1-li... 59 5e-07 ref|XP_002284859.2| PREDICTED: dof zinc finger protein DOF2.1-li... 57 2e-06 emb|CBI16255.3| unnamed protein product [Vitis vinifera] 57 2e-06 emb|CAN67628.1| hypothetical protein VITISV_019216 [Vitis vinifera] 57 2e-06 >gb|AAT39305.2| Dof domain, zinc finger family protein [Solanum demissum] Length = 299 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 168 MSSQTLESMLVCNKTQQDQKKPRPPAEEALKCPRCDSS 281 MSSQTLESMLVC K QDQKKPRP ++ KCPRCDS+ Sbjct: 8 MSSQTLESMLVCTKPDQDQKKPRPAEQQPQKCPRCDSA 45 >ref|XP_003539737.1| PREDICTED: dof zinc finger protein DOF2.1-like [Glycine max] Length = 305 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +3 Query: 162 EMMSSQTLESMLVCNKTQQDQKKPRPPAEEALKCPRCDSS 281 + MSSQ+LE+ML C+K QQ+ +KPRP E+ALKCPRCDS+ Sbjct: 9 QQMSSQSLENMLACSKAQQE-RKPRPQPEQALKCPRCDST 47 >ref|XP_002284859.2| PREDICTED: dof zinc finger protein DOF2.1-like [Vitis vinifera] Length = 286 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 168 MSSQTLESMLVCNKTQQDQKKPRPPAEEALKCPRCDSS 281 M +Q+LESMLVC+K QQ ++KPRPP E+ALKCPRCDS+ Sbjct: 1 MDTQSLESMLVCSKAQQ-ERKPRPP-EQALKCPRCDST 36 >emb|CBI16255.3| unnamed protein product [Vitis vinifera] Length = 272 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 168 MSSQTLESMLVCNKTQQDQKKPRPPAEEALKCPRCDSS 281 M +Q+LESMLVC+K QQ ++KPRPP E+ALKCPRCDS+ Sbjct: 11 MDTQSLESMLVCSKAQQ-ERKPRPP-EQALKCPRCDST 46 >emb|CAN67628.1| hypothetical protein VITISV_019216 [Vitis vinifera] Length = 343 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 168 MSSQTLESMLVCNKTQQDQKKPRPPAEEALKCPRCDSS 281 M +Q+LESMLVC+K QQ ++KPRPP E+ALKCPRCDS+ Sbjct: 1 MDTQSLESMLVCSKAQQ-ERKPRPP-EQALKCPRCDST 36