BLASTX nr result
ID: Atractylodes21_contig00043851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00043851 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281118.2| PREDICTED: transcription factor bHLH110-like... 59 4e-07 emb|CAN61992.1| hypothetical protein VITISV_030445 [Vitis vinifera] 59 4e-07 ref|XP_002510430.1| transcription factor, putative [Ricinus comm... 56 3e-06 ref|XP_002300753.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_004164011.1| PREDICTED: transcription factor bHLH110-like... 55 5e-06 >ref|XP_002281118.2| PREDICTED: transcription factor bHLH110-like [Vitis vinifera] gi|302142540|emb|CBI19743.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = -1 Query: 261 DGNEETKRDLRSRGLCLVPLSCLSYVTYGC--GSVWATP 151 +G+EE +RDLRSRGLCLVPLSC+SYVT C G VW P Sbjct: 383 EGSEEPRRDLRSRGLCLVPLSCMSYVTTDCGGGGVWPPP 421 >emb|CAN61992.1| hypothetical protein VITISV_030445 [Vitis vinifera] Length = 512 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = -1 Query: 261 DGNEETKRDLRSRGLCLVPLSCLSYVTYGC--GSVWATP 151 +G+EE +RDLRSRGLCLVPLSC+SYVT C G VW P Sbjct: 408 EGSEEPRRDLRSRGLCLVPLSCMSYVTTDCGGGGVWPPP 446 >ref|XP_002510430.1| transcription factor, putative [Ricinus communis] gi|223551131|gb|EEF52617.1| transcription factor, putative [Ricinus communis] Length = 436 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = -1 Query: 291 RTSTRRGSIKDGNEETKRDLRSRGLCLVPLSCLSYVT----YGCGSVWATP 151 R S ++++GN E K+DLRSRGLCLVPLSC+SYVT G++W P Sbjct: 380 RNSQSGPTVEEGNFEPKKDLRSRGLCLVPLSCMSYVTGDGGGSSGNIWPPP 430 >ref|XP_002300753.1| predicted protein [Populus trichocarpa] gi|222842479|gb|EEE80026.1| predicted protein [Populus trichocarpa] Length = 98 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 3/36 (8%) Frame = -1 Query: 258 GNEETKRDLRSRGLCLVPLSCLSYVTY---GCGSVW 160 G+EE KRDLRSRGLCLVPLSC+SYVT G GS+W Sbjct: 61 GDEEPKRDLRSRGLCLVPLSCMSYVTSDGGGGGSIW 96 >ref|XP_004164011.1| PREDICTED: transcription factor bHLH110-like [Cucumis sativus] Length = 427 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Frame = -1 Query: 282 TRRGSIKDGNEETK-RDLRSRGLCLVPLSCLSYVTYGCG---SVWATP 151 T R S++DGNE + RDLRSRGLCLVPL CLSYVT G +W P Sbjct: 373 THRSSVEDGNEGGQNRDLRSRGLCLVPLGCLSYVTGDSGGGVGIWPPP 420