BLASTX nr result
ID: Atractylodes21_contig00043792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00043792 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514661.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 ref|XP_002454266.1| hypothetical protein SORBIDRAFT_04g027763 [S... 63 3e-08 ref|XP_004166632.1| PREDICTED: uncharacterized LOC101223019 [Cuc... 62 5e-08 ref|XP_004137599.1| PREDICTED: uncharacterized protein LOC101223... 62 5e-08 gb|EEE59275.1| hypothetical protein OsJ_11306 [Oryza sativa Japo... 59 5e-07 >ref|XP_002514661.1| conserved hypothetical protein [Ricinus communis] gi|223546265|gb|EEF47767.1| conserved hypothetical protein [Ricinus communis] Length = 565 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/80 (46%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +3 Query: 6 PALNAYWKGSF-YLPNGPTECFDEAFKAHPPSRVHSKVYETLKKLPKKIQFELVPKREVW 182 PALN WKG F ++ F F+A PPSRV + YE +K+P +Q EL+P R VW Sbjct: 321 PALNVTWKGGFKFIDTAKPGKFYGGFQAQPPSRVSRRAYELAQKMPIVLQIELLP-RHVW 379 Query: 183 MEIFPGYCPDSDDIGLYFFP 242 ++F PD DI LYFFP Sbjct: 380 ADVFQKDYPDFRDIALYFFP 399 >ref|XP_002454266.1| hypothetical protein SORBIDRAFT_04g027763 [Sorghum bicolor] gi|241934097|gb|EES07242.1| hypothetical protein SORBIDRAFT_04g027763 [Sorghum bicolor] Length = 110 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/78 (38%), Positives = 46/78 (58%) Frame = +3 Query: 6 PALNAYWKGSFYLPNGPTECFDEAFKAHPPSRVHSKVYETLKKLPKKIQFELVPKREVWM 185 PA W+G F++ N + FKA PS+V S+VY+T+K +P +Q EL+P+ W Sbjct: 27 PAPAICWRGCFHVFNAGAKLNLGEFKAQFPSKVSSRVYDTIKMIPSDLQLELLPRMNDWP 86 Query: 186 EIFPGYCPDSDDIGLYFF 239 + F P +DIG++FF Sbjct: 87 KSFETIPPVHEDIGVFFF 104 >ref|XP_004166632.1| PREDICTED: uncharacterized LOC101223019 [Cucumis sativus] Length = 302 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Frame = +3 Query: 66 FDEAFKAHPPSRVHSKVYETLKKLPKKIQFELVPKREVWMEIFPGYCPDSDDIGLYFFP- 242 F + F A PP V+ +VYE +K+P +Q +LV + ++W ++F CPD D+ LYFFP Sbjct: 5 FYDGFLAKPPCAVYGRVYELSRKIPPILQVKLVSRSDIWNDLFHDECPDLADVALYFFPC 64 Query: 243 ---RSKK 254 RS+K Sbjct: 65 NIERSRK 71 >ref|XP_004137599.1| PREDICTED: uncharacterized protein LOC101223019 [Cucumis sativus] Length = 302 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Frame = +3 Query: 66 FDEAFKAHPPSRVHSKVYETLKKLPKKIQFELVPKREVWMEIFPGYCPDSDDIGLYFFP- 242 F + F A PP V+ +VYE +K+P +Q +LV + ++W ++F CPD D+ LYFFP Sbjct: 5 FYDGFLAKPPCAVYGRVYELSRKIPPILQVKLVSRSDIWNDLFHDECPDLADVALYFFPC 64 Query: 243 ---RSKK 254 RS+K Sbjct: 65 NIERSRK 71 >gb|EEE59275.1| hypothetical protein OsJ_11306 [Oryza sativa Japonica Group] Length = 408 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/72 (38%), Positives = 43/72 (59%) Frame = +3 Query: 24 WKGSFYLPNGPTECFDEAFKAHPPSRVHSKVYETLKKLPKKIQFELVPKREVWMEIFPGY 203 W G F + NG + C FKA+ PS+V SKV +K +P I+ +++P+ + W + F Sbjct: 292 WTGCFLVSNG-SNCNPADFKAYCPSKVSSKVLNVIKSMPSIIELDILPRMDEWPKSFEIN 350 Query: 204 CPDSDDIGLYFF 239 P +DIGL+FF Sbjct: 351 PPVYEDIGLFFF 362