BLASTX nr result
ID: Atractylodes21_contig00042838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042838 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279094.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 56 3e-06 ref|XP_002870205.1| hypothetical protein ARALYDRAFT_493299 [Arab... 55 8e-06 >ref|XP_002279094.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 1 [Vitis vinifera] gi|297740757|emb|CBI30939.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -2 Query: 405 ESYQSWLPTMLQCTRSSVDGLFAYASTPIPSTFGPLKTIRR 283 E+YQSWLPT+LQ TRSS + LF T +PSTFG + TIRR Sbjct: 213 EAYQSWLPTVLQLTRSSDESLFPCGKTILPSTFGSMNTIRR 253 >ref|XP_002870205.1| hypothetical protein ARALYDRAFT_493299 [Arabidopsis lyrata subsp. lyrata] gi|297316041|gb|EFH46464.1| hypothetical protein ARALYDRAFT_493299 [Arabidopsis lyrata subsp. lyrata] Length = 522 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -2 Query: 405 ESYQSWLPTMLQCTRSSVDGLFAYASTPIPSTFGPLKTIRR 283 E+YQSWLPT+LQ T++S DGLF + +PS FG L+T+RR Sbjct: 215 EAYQSWLPTVLQLTQTSDDGLFPSCTPFVPSAFGSLRTVRR 255