BLASTX nr result
ID: Atractylodes21_contig00042201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042201 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ23784.2| type II homeodomain-leucine zipper protein [Medic... 62 5e-08 ref|XP_003595805.1| Homeobox-leucine zipper protein HAT14 [Medic... 62 5e-08 gb|ADI50270.1| type II homeodomain-leucine zipper protein [Medic... 62 5e-08 ref|XP_002268178.1| PREDICTED: homeobox-leucine zipper protein H... 62 5e-08 ref|XP_002512174.1| homeobox protein, putative [Ricinus communis... 62 5e-08 >gb|AAZ23784.2| type II homeodomain-leucine zipper protein [Medicago sativa] Length = 340 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 HKELQELRALKTTSNPFSVQLPATTLTMCPACVRV 105 HKELQELRALKT SNPF++QLPATTLTMCP+C RV Sbjct: 280 HKELQELRALKT-SNPFNMQLPATTLTMCPSCERV 313 >ref|XP_003595805.1| Homeobox-leucine zipper protein HAT14 [Medicago truncatula] gi|355484853|gb|AES66056.1| Homeobox-leucine zipper protein HAT14 [Medicago truncatula] Length = 339 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 HKELQELRALKTTSNPFSVQLPATTLTMCPACVRV 105 HKELQELRALKT SNPF++QLPATTLTMCP+C RV Sbjct: 279 HKELQELRALKT-SNPFNMQLPATTLTMCPSCERV 312 >gb|ADI50270.1| type II homeodomain-leucine zipper protein [Medicago sativa] Length = 340 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 HKELQELRALKTTSNPFSVQLPATTLTMCPACVRV 105 HKELQELRALKT SNPF++QLPATTLTMCP+C RV Sbjct: 280 HKELQELRALKT-SNPFNMQLPATTLTMCPSCERV 313 >ref|XP_002268178.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Vitis vinifera] Length = 358 Score = 62.0 bits (149), Expect = 5e-08 Identities = 38/85 (44%), Positives = 44/85 (51%) Frame = +1 Query: 1 HKELQELRALKTTSNPFSVQLPATTLTMCPACVRVXXXXXXXXXXXXXXXXXXXXXXNTK 180 HKELQELRALKT SNPF +QLPATTLTMCP+C RV Sbjct: 281 HKELQELRALKT-SNPFYMQLPATTLTMCPSCERVAATSTAPSA--------------AA 325 Query: 181 LRKSMSTTPCTSFPQTSKRTSLYPF 255 + +T P T+ T+ R YPF Sbjct: 326 STATTATDPSTTTTTTANRPRFYPF 350 >ref|XP_002512174.1| homeobox protein, putative [Ricinus communis] gi|223548718|gb|EEF50208.1| homeobox protein, putative [Ricinus communis] Length = 378 Score = 62.0 bits (149), Expect = 5e-08 Identities = 39/90 (43%), Positives = 50/90 (55%), Gaps = 3/90 (3%) Frame = +1 Query: 1 HKELQELRALKTTSNPFSVQLPATTLTMCPACVRVXXXXXXXXXXXXXXXXXXXXXXNTK 180 HKELQELRAL T+SNPF +Q+PATTLTMCP+C RV T Sbjct: 288 HKELQELRAL-TSSNPFYMQVPATTLTMCPSCERV---------ATTSTATATTTTTTTT 337 Query: 181 LRKSMSTTPCTSFP---QTSKRTSLYPFLY 261 + ++ST P +S S +T LYPF++ Sbjct: 338 TKNNISTEPASSKGTGLSLSTKTRLYPFVH 367