BLASTX nr result
ID: Atractylodes21_contig00040481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040481 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_861410.1| putative multifunctional pol protein [Cestrum y... 76 3e-12 ref|NP_068729.1| putative reverse transcriptase [Soybean chlorot... 72 5e-11 ref|NP_042513.1| reverse transcriptase [Peanut chlorotic streak ... 59 4e-07 >ref|NP_861410.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] gi|75559686|sp|Q7TD08.1|POL_CYLCV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|32305282|gb|AAP78924.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] Length = 643 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = +3 Query: 108 QQKINPYATFIKVKIQNKNIVALIDTGATLCLGNKRIIKNWEKLEKPLKIIVADKSIHEI 287 + K NP ATFI VKI + I A +DTGAT+CL + +I W K+EKP+KI +ADKS+ EI Sbjct: 2 KSKGNPNATFITVKINDVFINAYVDTGATICLADPKIKLKWVKMEKPIKISIADKSVQEI 61 Query: 288 WMVAKFVE 311 W A+ VE Sbjct: 62 WHRAEMVE 69 >ref|NP_068729.1| putative reverse transcriptase [Soybean chlorotic mottle virus] gi|18266821|sp|P15629.2|POL_SOCMV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|11322953|emb|CAC16945.1| putative reverse transcriptase [Soybean chlorotic mottle virus] Length = 692 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/72 (51%), Positives = 47/72 (65%) Frame = +3 Query: 114 KINPYATFIKVKIQNKNIVALIDTGATLCLGNKRIIKNWEKLEKPLKIIVADKSIHEIWM 293 K NP TFIKV I +N +A IDTGATLC G ++I NWE L++P +II+ADKS H I Sbjct: 14 KGNPNVTFIKVSIGKRNFLAYIDTGATLCFGKRKISNNWEILKQPKEIIIADKSKHYIRE 73 Query: 294 VAKFVEAEIEKE 329 V +IE + Sbjct: 74 AISNVFLKIENK 85 >ref|NP_042513.1| reverse transcriptase [Peanut chlorotic streak virus] gi|555885|gb|AAA50240.1| reverse transcriptase [Peanut chlorotic streak virus] Length = 694 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = +3 Query: 129 ATFIKVKIQNKNIVALIDTGATLCLGNKRI--IKNWEKLEKPLKIIVADKSIHEIWMVA 299 ++FIKVK+ NK + A IDTGAT+CL +I IK W+K+ KP+K+ +A+ + IW A Sbjct: 6 SSFIKVKLFNKYLYAYIDTGATICLAQAKILPIKYWKKMIKPIKVRIANNKVIHIWYKA 64