BLASTX nr result
ID: Atractylodes21_contig00040468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040468 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447205.1| hypothetical protein SORBIDRAFT_06g030420 [S... 84 8e-16 ref|NP_974953.1| cyclic nucleotide gated channel [Arabidopsis th... 81 8e-14 ref|XP_002864540.1| ATCNGC5 [Arabidopsis lyrata subsp. lyrata] g... 81 8e-14 ref|NP_851209.1| cyclic nucleotide gated channel [Arabidopsis th... 81 8e-14 ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putativ... 78 7e-13 >ref|XP_002447205.1| hypothetical protein SORBIDRAFT_06g030420 [Sorghum bicolor] gi|241938388|gb|EES11533.1| hypothetical protein SORBIDRAFT_06g030420 [Sorghum bicolor] Length = 721 Score = 83.6 bits (205), Expect(2) = 8e-16 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = +3 Query: 63 VLGTKKALLWIVIVQYIPRSVRILPLFSELKKTVGVITETAWSCAAYYLVWFVLAGH 233 VL TK AL+W+V++QYIPR RI P+ ++LK+T GV ETAW+ AAYYL+WF+LAGH Sbjct: 224 VLTTKTALVWVVLIQYIPRLFRIFPVTTDLKRTAGVFIETAWAGAAYYLLWFMLAGH 280 Score = 24.6 bits (52), Expect(2) = 8e-16 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 233 SVERKSTCWEQACSKDDKC 289 ++ER+ CW Q C + C Sbjct: 290 TIEREDDCWRQYCDPNTGC 308 >ref|NP_974953.1| cyclic nucleotide gated channel [Arabidopsis thaliana] gi|4581205|emb|CAB40130.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|9758363|dbj|BAB08864.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|332009592|gb|AED96975.1| cyclic nucleotide gated channel [Arabidopsis thaliana] Length = 710 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/58 (65%), Positives = 49/58 (84%) Frame = +3 Query: 63 VLGTKKALLWIVIVQYIPRSVRILPLFSELKKTVGVITETAWSCAAYYLVWFVLAGHL 236 VL TK+ALL+IV+VQYIPR +R+LPL SELK+T GV ETAW+ AAYYL+ ++LA H+ Sbjct: 212 VLATKQALLFIVLVQYIPRFLRVLPLTSELKRTAGVFAETAWAGAAYYLLLYMLASHI 269 >ref|XP_002864540.1| ATCNGC5 [Arabidopsis lyrata subsp. lyrata] gi|297310375|gb|EFH40799.1| ATCNGC5 [Arabidopsis lyrata subsp. lyrata] Length = 717 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/58 (65%), Positives = 49/58 (84%) Frame = +3 Query: 63 VLGTKKALLWIVIVQYIPRSVRILPLFSELKKTVGVITETAWSCAAYYLVWFVLAGHL 236 VL TK+ALL+IV+VQYIPR +R+LPL SELK+T GV ETAW+ AAYYL+ ++LA H+ Sbjct: 219 VLATKQALLFIVLVQYIPRFLRVLPLTSELKRTAGVFAETAWAGAAYYLLLYMLASHI 276 >ref|NP_851209.1| cyclic nucleotide gated channel [Arabidopsis thaliana] gi|42568613|ref|NP_200602.2| cyclic nucleotide gated channel [Arabidopsis thaliana] gi|38503077|sp|Q8RWS9.1|CNGC5_ARATH RecName: Full=Probable cyclic nucleotide-gated ion channel 5; Short=AtCNGC5; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 5 gi|20268758|gb|AAM14082.1| putative cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|21281123|gb|AAM45101.1| putative cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|222423973|dbj|BAH19948.1| AT5G57940 [Arabidopsis thaliana] gi|332009591|gb|AED96974.1| cyclic nucleotide gated channel [Arabidopsis thaliana] gi|332009593|gb|AED96976.1| cyclic nucleotide gated channel [Arabidopsis thaliana] Length = 717 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/58 (65%), Positives = 49/58 (84%) Frame = +3 Query: 63 VLGTKKALLWIVIVQYIPRSVRILPLFSELKKTVGVITETAWSCAAYYLVWFVLAGHL 236 VL TK+ALL+IV+VQYIPR +R+LPL SELK+T GV ETAW+ AAYYL+ ++LA H+ Sbjct: 219 VLATKQALLFIVLVQYIPRFLRVLPLTSELKRTAGVFAETAWAGAAYYLLLYMLASHI 276 >ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223531133|gb|EEF32981.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 735 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/58 (62%), Positives = 48/58 (82%) Frame = +3 Query: 63 VLGTKKALLWIVIVQYIPRSVRILPLFSELKKTVGVITETAWSCAAYYLVWFVLAGHL 236 VL TK+ALL+IV++QYIPR +RI PLFSE+K+T GV ETAW+ AA YL+ ++LA H+ Sbjct: 231 VLATKQALLFIVLLQYIPRFLRIFPLFSEMKRTTGVFAETAWAGAACYLLMYMLASHI 288