BLASTX nr result
ID: Atractylodes21_contig00040282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040282 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526092.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_003554910.1| PREDICTED: uncharacterized protein LOC100797... 59 3e-07 ref|XP_003543867.1| PREDICTED: uncharacterized protein LOC100791... 59 4e-07 ref|XP_003618715.1| hypothetical protein MTR_6g015010 [Medicago ... 59 5e-07 ref|NP_197055.2| TPX2 (targeting protein for Xklp2) family prote... 58 9e-07 >ref|XP_002526092.1| conserved hypothetical protein [Ricinus communis] gi|223534589|gb|EEF36286.1| conserved hypothetical protein [Ricinus communis] Length = 540 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 307 PYFDRPFIPKRSEKQPTLPKEPKFHNHQHKKM 212 PYFDRPFIP+RS K PT+PKEPKFH QHKK+ Sbjct: 492 PYFDRPFIPRRSTKLPTIPKEPKFHIPQHKKI 523 >ref|XP_003554910.1| PREDICTED: uncharacterized protein LOC100797243 [Glycine max] Length = 487 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 307 PYFDRPFIPKRSEKQPTLPKEPKFHNHQHKKM 212 PYFDRPF+P+RS K PT+P+EPKFH QHKK+ Sbjct: 450 PYFDRPFVPRRSMKHPTIPREPKFHMPQHKKI 481 >ref|XP_003543867.1| PREDICTED: uncharacterized protein LOC100791493 [Glycine max] Length = 489 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 307 PYFDRPFIPKRSEKQPTLPKEPKFHNHQHKKM 212 PYFDRPF+P+RS K PT+P+EPKFH QHKK+ Sbjct: 441 PYFDRPFVPRRSMKHPTIPREPKFHIPQHKKI 472 >ref|XP_003618715.1| hypothetical protein MTR_6g015010 [Medicago truncatula] gi|355493730|gb|AES74933.1| hypothetical protein MTR_6g015010 [Medicago truncatula] Length = 484 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 307 PYFDRPFIPKRSEKQPTLPKEPKFHNHQHKKM 212 PYFDRPFIP+RS K PT+PKEPKFH HKK+ Sbjct: 437 PYFDRPFIPRRSMKNPTIPKEPKFHIPHHKKI 468 >ref|NP_197055.2| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis thaliana] gi|332004787|gb|AED92170.1| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis thaliana] Length = 497 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 307 PYFDRPFIPKRSEKQPTLPKEPKFHNHQHKKM 212 PYFDRPFIP+RS K PT P++PKFH QHKK+ Sbjct: 443 PYFDRPFIPRRSSKHPTAPRDPKFHIPQHKKI 474