BLASTX nr result
ID: Atractylodes21_contig00040095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00040095 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_173848.2| uncharacterized protein [Arabidopsis thaliana] ... 57 2e-06 gb|ABK28413.1| unknown [Arabidopsis thaliana] 57 2e-06 >ref|NP_173848.2| uncharacterized protein [Arabidopsis thaliana] gi|9743328|gb|AAF97952.1|AC000103_2 F21J9.4 [Arabidopsis thaliana] gi|91805847|gb|ABE65652.1| hypothetical protein At1g24380 [Arabidopsis thaliana] gi|332192402|gb|AEE30523.1| uncharacterized protein [Arabidopsis thaliana] Length = 293 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 35 KRTTRSLESRMAIIQKAVSKLRGFVNQIQNLNPSGASEQDIVS 163 +R RSL++RM I AVSKLRG VNQI+N NPSGASE+DI++ Sbjct: 11 RRPKRSLQTRMTSILSAVSKLRGCVNQIENKNPSGASEEDILN 53 >gb|ABK28413.1| unknown [Arabidopsis thaliana] Length = 294 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 35 KRTTRSLESRMAIIQKAVSKLRGFVNQIQNLNPSGASEQDIVS 163 +R RSL++RM I AVSKLRG VNQI+N NPSGASE+DI++ Sbjct: 11 RRPKRSLQTRMTSILSAVSKLRGCVNQIENKNPSGASEEDILN 53