BLASTX nr result
ID: Atractylodes21_contig00038983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038983 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein ... 88 8e-16 emb|CBI30704.3| unnamed protein product [Vitis vinifera] 88 8e-16 ref|XP_002522229.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_004150223.1| PREDICTED: DUF246 domain-containing protein ... 57 2e-06 ref|XP_004161210.1| PREDICTED: DUF246 domain-containing protein ... 55 8e-06 >ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 628 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/69 (59%), Positives = 50/69 (72%) Frame = +3 Query: 9 WDKLELFHGLRSNSMKFGSFKGAYVGKRHSWIRKHFSSIVFTVALMGFLFLLDSLMGSIF 188 W++ L HGL++ KFG+ KG YVGK+H+W RKH S+VF LMGFLFLLDSLM SIF Sbjct: 52 WNRNLLLHGLKNEPAKFGACKGVYVGKKHTWFRKHVRSVVFMFGLMGFLFLLDSLMVSIF 111 Query: 189 EPSVLQSSS 215 + LQ SS Sbjct: 112 DSMNLQGSS 120 >emb|CBI30704.3| unnamed protein product [Vitis vinifera] Length = 629 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/69 (59%), Positives = 50/69 (72%) Frame = +3 Query: 9 WDKLELFHGLRSNSMKFGSFKGAYVGKRHSWIRKHFSSIVFTVALMGFLFLLDSLMGSIF 188 W++ L HGL++ KFG+ KG YVGK+H+W RKH S+VF LMGFLFLLDSLM SIF Sbjct: 52 WNRNLLLHGLKNEPAKFGACKGVYVGKKHTWFRKHVRSVVFMFGLMGFLFLLDSLMVSIF 111 Query: 189 EPSVLQSSS 215 + LQ SS Sbjct: 112 DSMNLQGSS 120 >ref|XP_002522229.1| conserved hypothetical protein [Ricinus communis] gi|223538482|gb|EEF40087.1| conserved hypothetical protein [Ricinus communis] Length = 598 Score = 69.7 bits (169), Expect = 2e-10 Identities = 37/68 (54%), Positives = 46/68 (67%) Frame = +3 Query: 12 DKLELFHGLRSNSMKFGSFKGAYVGKRHSWIRKHFSSIVFTVALMGFLFLLDSLMGSIFE 191 +K+ L GL++ K GS KG Y+GKRH W RKH SI+F AL+ FLFLLDSLM SIF+ Sbjct: 49 NKVALLDGLKNEYGKLGS-KGIYIGKRHIWFRKHAKSIIFMFALLCFLFLLDSLMVSIFD 107 Query: 192 PSVLQSSS 215 +Q S Sbjct: 108 SINVQVGS 115 >ref|XP_004150223.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 630 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/53 (45%), Positives = 38/53 (71%) Frame = +3 Query: 27 FHGLRSNSMKFGSFKGAYVGKRHSWIRKHFSSIVFTVALMGFLFLLDSLMGSI 185 FHGL+ + K + KG+Y GKR+ W++KH SI+F + ++ F+FL+DSL S+ Sbjct: 59 FHGLKHDFSKLSASKGSYGGKRNFWLQKHVRSILFMIGVIAFVFLVDSLTVSL 111 >ref|XP_004161210.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 630 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/52 (44%), Positives = 37/52 (71%) Frame = +3 Query: 30 HGLRSNSMKFGSFKGAYVGKRHSWIRKHFSSIVFTVALMGFLFLLDSLMGSI 185 HGL+ + K + KG+Y GKR+ W++KH SI+F + ++ F+FL+DSL S+ Sbjct: 60 HGLKHDFSKLSASKGSYGGKRNFWLQKHVRSILFMIGVIAFVFLVDSLTVSL 111