BLASTX nr result
ID: Atractylodes21_contig00038916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038916 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635698.1| hypothetical protein MTR_001s0023 [Medicago ... 55 6e-06 >ref|XP_003635698.1| hypothetical protein MTR_001s0023 [Medicago truncatula] gi|355525253|gb|AET05647.1| hypothetical protein MTR_001s0023 [Medicago truncatula] Length = 128 Score = 55.1 bits (131), Expect = 6e-06 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%) Frame = -2 Query: 244 EPERTFRARRKEQR-KAKMSDGEDAGNGNGGRRIRDYAIPTMQGINNPIVNPEIQADNFE 68 E ER RR+ +R A+M+ N R ++D+A+P+ ++ IVNP IQA+NFE Sbjct: 17 EIERFLHIRRQVERIHAQMALAH-----NANRPLKDFAVPSQDEPHSSIVNPTIQANNFE 71 Query: 67 LKPVMFQMLQTIGQFGGTPTDD 2 LKP + Q++Q QF G T+D Sbjct: 72 LKPSLLQIVQQ-NQFSGNSTED 92