BLASTX nr result
ID: Atractylodes21_contig00038904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038904 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical p... 65 6e-09 ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SST... 65 6e-09 ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces ... 65 7e-09 ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis... 62 6e-08 ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis... 60 2e-07 >ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302426770|gb|EFK98585.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 103 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 176 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SA 289 AGT ISTGYPSTTPVGLALGPD P AD+LDPGTL SA Sbjct: 1 AGTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSA 38 >ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] gi|292833481|gb|EFF91830.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] Length = 106 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 176 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SA 289 AGT ISTGYPSTTPVGLALGPD P AD+LDPGTL SA Sbjct: 4 AGTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSA 41 >ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces sp. C] gi|302535772|ref|ZP_07288114.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444023|gb|EFL15839.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444667|gb|EFL16483.1| conserved hypothetical protein [Streptomyces sp. C] Length = 179 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +2 Query: 164 GR*QAGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SA 289 GR +AGT ISTG PSTTPVGLALGPD P AD+LDPGTL SA Sbjct: 39 GRFKAGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSA 80 >ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291438707|ref|ZP_06578097.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291440884|ref|ZP_06580274.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291340929|gb|EFE67885.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291341602|gb|EFE68558.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291343779|gb|EFE70735.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 176 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SA 289 AGT ISTG PSTTPVGLALGPD P AD+LDPGTL SA Sbjct: 9 AGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSA 46 >ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291342161|gb|EFE69117.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +2 Query: 176 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTL 277 AGT ISTG PSTTPVGLALGPD P AD+LDPGTL Sbjct: 9 AGTGISTGCPSTTPVGLALGPDLPWADQLDPGTL 42