BLASTX nr result
ID: Atractylodes21_contig00038638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00038638 (1177 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638432.1| Craniofacial development protein [Medicago t... 37 4e-06 emb|CCH50976.1| T4.15 [Malus x robusta] 39 4e-06 >ref|XP_003638432.1| Craniofacial development protein [Medicago truncatula] gi|355504367|gb|AES85570.1| Craniofacial development protein [Medicago truncatula] Length = 349 Score = 37.4 bits (85), Expect(3) = 4e-06 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -3 Query: 110 RFGEEMDDLVAGLTSDQHVYIGGDFNGHIAEVANGY 3 +F EE++ L+ + + +++GGD NGH+ V+ G+ Sbjct: 179 KFWEELEGLIQEIPLGEKIFLGGDLNGHVGSVSRGF 214 Score = 30.4 bits (67), Expect(3) = 4e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -1 Query: 208 DRIMALRIVIGAGVVNVVCAYAPQAGL 128 DRI+AL+IV+ +V+ A APQ GL Sbjct: 146 DRIIALKIVVEQDTFDVISANAPQVGL 172 Score = 29.3 bits (64), Expect(3) = 4e-06 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 9/46 (19%) Frame = -2 Query: 324 SKWKGEKTRK---------GSGLVSKRNDVGIMLKAELKDSVVEVN 214 +KW G+K ++ +G V RN VGI++ E K +V+VN Sbjct: 97 TKWVGKKAKELDSSGFKLWYTGEVRSRNGVGIIVDKEWKKDIVDVN 142 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 39.3 bits (90), Expect(2) = 4e-06 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -3 Query: 116 ERRFGEEMDDLVAGLTSDQHVYIGGDFNGHIAEVANGY 3 + +F E++ DLV G+ + ++IGGD NGH+ Y Sbjct: 214 KEKFWEDLGDLVQGIAQTEKLFIGGDLNGHVGRETGNY 251 Score = 38.5 bits (88), Expect(2) = 4e-06 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = -1 Query: 208 DRIMALRIVIGAGVVNVVCAYAPQAGL 128 DRIMA++IVI ++NV+ AYAPQ GL Sbjct: 183 DRIMAIKIVIRQELINVISAYAPQVGL 209