BLASTX nr result
ID: Atractylodes21_contig00036711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00036711 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527541.1| histidine kinase 1, 2, 3 plant, putative [Ri... 48 6e-07 ref|XP_003560605.1| PREDICTED: histidine kinase 4-like [Brachypo... 46 3e-06 gb|ACE63259.1| cytokinin receptor 1 [Betula pendula] 50 4e-06 gb|ABD49494.1| cytokinin receptor 1 [Physcomitrella patens] 42 5e-06 ref|XP_001761753.1| cytokinin receptor AtAHK4-like protein [Phys... 42 5e-06 >ref|XP_002527541.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] gi|223533091|gb|EEF34850.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] Length = 1011 Score = 48.1 bits (113), Expect(2) = 6e-07 Identities = 28/51 (54%), Positives = 30/51 (58%) Frame = -2 Query: 182 FMRFMQVDSSTSRHCXXXXXX*VSAVVLVELMGG*RSFGSTPQTGSIFCFT 30 FM FMQ DSSTSR+ + LVELMGG SF S PQ GS F FT Sbjct: 630 FMPFMQADSSTSRNYGGTGIGLSISKCLVELMGGHISFVSRPQVGSTFSFT 680 Score = 30.0 bits (66), Expect(2) = 6e-07 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 253 EKINPAASAEDT*IGIPLHVQDIV 182 E + S EDT IGIPLH QD V Sbjct: 606 ENVTLVVSVEDTGIGIPLHAQDRV 629 >ref|XP_003560605.1| PREDICTED: histidine kinase 4-like [Brachypodium distachyon] Length = 997 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 26/53 (49%), Positives = 30/53 (56%) Frame = -2 Query: 182 FMRFMQVDSSTSRHCXXXXXX*VSAVVLVELMGG*RSFGSTPQTGSIFCFTVI 24 F FMQ DSSTSR+ + LVELMGG +F S PQ GS F FT + Sbjct: 618 FTPFMQADSSTSRNYGGTGIGLSISQCLVELMGGQINFVSRPQVGSTFTFTAV 670 Score = 30.0 bits (66), Expect(2) = 3e-06 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 253 EKINPAASAEDT*IGIPLHVQDIV 182 +K+ S EDT IGIP+H QD V Sbjct: 594 DKVTLVVSVEDTGIGIPIHAQDRV 617 >gb|ACE63259.1| cytokinin receptor 1 [Betula pendula] Length = 1004 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 28/53 (52%), Positives = 31/53 (58%) Frame = -2 Query: 182 FMRFMQVDSSTSRHCXXXXXX*VSAVVLVELMGG*RSFGSTPQTGSIFCFTVI 24 FM FMQ DSSTSRH + LVELMGG +F S PQ GS F FT + Sbjct: 623 FMPFMQADSSTSRHYGGTGIGLSISKCLVELMGGQINFISRPQVGSTFSFTAV 675 Score = 25.0 bits (53), Expect(2) = 4e-06 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 262 ETGEKINPAASAEDT*IGIPLHVQDIV 182 E E + EDT IGIPL QD V Sbjct: 596 EASEHVTLMVCVEDTGIGIPLCAQDRV 622 >gb|ABD49494.1| cytokinin receptor 1 [Physcomitrella patens] Length = 1075 Score = 42.4 bits (98), Expect(2) = 5e-06 Identities = 25/52 (48%), Positives = 28/52 (53%) Frame = -2 Query: 182 FMRFMQVDSSTSRHCXXXXXX*VSAVVLVELMGG*RSFGSTPQTGSIFCFTV 27 F FMQ DSSTSR+ + LVELM G F S P+ GS F FTV Sbjct: 662 FTPFMQADSSTSRNYGGTGIGLSISRCLVELMSGEMGFVSRPKVGSTFTFTV 713 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 262 ETGEKINPAASAEDT*IGIPLHVQDIV 182 ++ + +N S EDT +GIPLHVQD V Sbjct: 635 DSSDVVNLVVSVEDTGVGIPLHVQDRV 661 >ref|XP_001761753.1| cytokinin receptor AtAHK4-like protein [Physcomitrella patens subsp. patens] gi|162687124|gb|EDQ73509.1| cytokinin receptor AtAHK4-like protein [Physcomitrella patens subsp. patens] Length = 1022 Score = 42.4 bits (98), Expect(2) = 5e-06 Identities = 25/52 (48%), Positives = 28/52 (53%) Frame = -2 Query: 182 FMRFMQVDSSTSRHCXXXXXX*VSAVVLVELMGG*RSFGSTPQTGSIFCFTV 27 F FMQ DSSTSR+ + LVELM G F S P+ GS F FTV Sbjct: 642 FTPFMQADSSTSRNYGGTGIGLSISRCLVELMSGEMGFVSRPKVGSTFTFTV 693 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 262 ETGEKINPAASAEDT*IGIPLHVQDIV 182 ++ + +N S EDT +GIPLHVQD V Sbjct: 615 DSSDVVNLVVSVEDTGVGIPLHVQDRV 641