BLASTX nr result
ID: Atractylodes21_contig00032357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032357 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147963.1| PREDICTED: histone deacetylase complex subun... 75 7e-12 ref|XP_004133896.1| PREDICTED: histone deacetylase complex subun... 73 2e-11 gb|AEO34811.1| hypothetical protein [Amblyomma maculatum] 72 5e-11 ref|XP_002277566.1| PREDICTED: histone deacetylase complex subun... 70 2e-10 ref|NP_566050.1| histone deacetylase complex subunit SAP18 [Arab... 69 4e-10 >ref|XP_004147963.1| PREDICTED: histone deacetylase complex subunit SAP18-like [Cucumis sativus] gi|449494271|ref|XP_004159498.1| PREDICTED: histone deacetylase complex subunit SAP18-like [Cucumis sativus] Length = 166 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/39 (87%), Positives = 34/39 (87%) Frame = -3 Query: 119 PGNRFEPVDREKTCPLLLRVFTKTGGHHTQADFAVRGKE 3 P RFEPVDREKTCPLLLRVFTK GGHHT DFAVRGKE Sbjct: 40 PRPRFEPVDREKTCPLLLRVFTKVGGHHTDEDFAVRGKE 78 >ref|XP_004133896.1| PREDICTED: histone deacetylase complex subunit SAP18-like [Cucumis sativus] gi|449480076|ref|XP_004155792.1| PREDICTED: histone deacetylase complex subunit SAP18-like [Cucumis sativus] Length = 148 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -3 Query: 131 THNKPGNRFEPVDREKTCPLLLRVFTKTGGHHTQADFAVRGKE 3 TH P R EPVDREKTCPLLLRVFTKTG HH DFAVRGKE Sbjct: 19 THAPPRPRLEPVDREKTCPLLLRVFTKTGSHHFNEDFAVRGKE 61 >gb|AEO34811.1| hypothetical protein [Amblyomma maculatum] Length = 153 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 110 RFEPVDREKTCPLLLRVFTKTGGHHTQADFAVRGKE 3 RFEPVDREKTCPLLLRVFTK GGHH + DFAVRGKE Sbjct: 30 RFEPVDREKTCPLLLRVFTKVGGHHVKEDFAVRGKE 65 >ref|XP_002277566.1| PREDICTED: histone deacetylase complex subunit SAP18 [Vitis vinifera] gi|296089118|emb|CBI38821.3| unnamed protein product [Vitis vinifera] Length = 152 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 119 PGNRFEPVDREKTCPLLLRVFTKTGGHHTQADFAVRGKE 3 P RFEPVDREKTCPLLLRVFTK G HH++ DFAVRGKE Sbjct: 26 PRPRFEPVDREKTCPLLLRVFTKIGCHHSKEDFAVRGKE 64 >ref|NP_566050.1| histone deacetylase complex subunit SAP18 [Arabidopsis thaliana] gi|6831680|sp|O64644.1|SAP18_ARATH RecName: Full=Histone deacetylase complex subunit SAP18; AltName: Full=18 kDa Sin3-associated polypeptide gi|14190397|gb|AAK55679.1|AF378876_1 At2g45640/F17K2.17 [Arabidopsis thaliana] gi|2979565|gb|AAC06174.1| expressed protein [Arabidopsis thaliana] gi|15215887|gb|AAK91487.1| At2g45640/F17K2.17 [Arabidopsis thaliana] gi|110743128|dbj|BAE99456.1| hypothetical protein [Arabidopsis thaliana] gi|330255486|gb|AEC10580.1| histone deacetylase complex subunit SAP18 [Arabidopsis thaliana] Length = 152 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 119 PGNRFEPVDREKTCPLLLRVFTKTGGHHTQADFAVRGKE 3 P + EPVDREKTCPLLLRVFTK+GGHHT D+AVRGKE Sbjct: 26 PRPKPEPVDREKTCPLLLRVFTKSGGHHTSEDYAVRGKE 64