BLASTX nr result
ID: Atractylodes21_contig00032098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032098 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156752.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic ... 115 4e-24 ref|XP_004148099.1| PREDICTED: pleiotropic drug resistance prote... 115 4e-24 gb|ACU82515.1| pleiotropic drug resistance protein [Cucumis sati... 115 4e-24 ref|XP_002514349.1| ATP-binding cassette transporter, putative [... 105 3e-21 ref|XP_002324840.1| predicted protein [Populus trichocarpa] gi|2... 103 1e-20 >ref|XP_004156752.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 1-like [Cucumis sativus] Length = 1451 Score = 115 bits (288), Expect = 4e-24 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +3 Query: 3 SHPAALTTEKYGLNKKELLKACTDREILLMKRNSFVYIFKLFQLLVMAFIALTVFFRTEM 182 SHPAALTTEKYG +KKELLKAC RE+LLMKRNSFVYIFKL QL++MAF+ +T+FFRTEM Sbjct: 486 SHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFFRTEM 545 Query: 183 HRRTVD 200 HRRTVD Sbjct: 546 HRRTVD 551 >ref|XP_004148099.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis sativus] Length = 1451 Score = 115 bits (288), Expect = 4e-24 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +3 Query: 3 SHPAALTTEKYGLNKKELLKACTDREILLMKRNSFVYIFKLFQLLVMAFIALTVFFRTEM 182 SHPAALTTEKYG +KKELLKAC RE+LLMKRNSFVYIFKL QL++MAF+ +T+FFRTEM Sbjct: 486 SHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFFRTEM 545 Query: 183 HRRTVD 200 HRRTVD Sbjct: 546 HRRTVD 551 >gb|ACU82515.1| pleiotropic drug resistance protein [Cucumis sativus] Length = 1451 Score = 115 bits (288), Expect = 4e-24 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +3 Query: 3 SHPAALTTEKYGLNKKELLKACTDREILLMKRNSFVYIFKLFQLLVMAFIALTVFFRTEM 182 SHPAALTTEKYG +KKELLKAC RE+LLMKRNSFVYIFKL QL++MAF+ +T+FFRTEM Sbjct: 486 SHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFFRTEM 545 Query: 183 HRRTVD 200 HRRTVD Sbjct: 546 HRRTVD 551 >ref|XP_002514349.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223546805|gb|EEF48303.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 1309 Score = 105 bits (263), Expect = 3e-21 Identities = 47/66 (71%), Positives = 58/66 (87%) Frame = +3 Query: 3 SHPAALTTEKYGLNKKELLKACTDREILLMKRNSFVYIFKLFQLLVMAFIALTVFFRTEM 182 +HPAALTT++YG++KKELLKAC RE LLMKRNSF YIFK+ QL++MAFI +T+F RTEM Sbjct: 346 AHPAALTTKRYGVSKKELLKACVSREFLLMKRNSFAYIFKMIQLIIMAFITMTIFLRTEM 405 Query: 183 HRRTVD 200 HR TV+ Sbjct: 406 HRNTVE 411 >ref|XP_002324840.1| predicted protein [Populus trichocarpa] gi|222866274|gb|EEF03405.1| predicted protein [Populus trichocarpa] Length = 1429 Score = 103 bits (258), Expect = 1e-20 Identities = 48/65 (73%), Positives = 56/65 (86%) Frame = +3 Query: 3 SHPAALTTEKYGLNKKELLKACTDREILLMKRNSFVYIFKLFQLLVMAFIALTVFFRTEM 182 SHPAALTTEKYG++KKELLKAC RE LLMKRNSFVYIFK QL+++A I +T+F RTEM Sbjct: 488 SHPAALTTEKYGVSKKELLKACISREFLLMKRNSFVYIFKFTQLIILASITMTIFLRTEM 547 Query: 183 HRRTV 197 HR T+ Sbjct: 548 HRNTI 552