BLASTX nr result
ID: Atractylodes21_contig00031421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031421 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_191327.4| Peptidase S41 family protein [Arabidopsis thali... 61 8e-08 ref|XP_002526736.1| protease, putative [Ricinus communis] gi|223... 61 8e-08 ref|XP_002876431.1| peptidase S41 family protein [Arabidopsis ly... 60 1e-07 emb|CAB41187.1| carboxyl terminal protease-like protein [Arabido... 60 1e-07 ref|XP_002277512.2| PREDICTED: carboxyl-terminal-processing prot... 59 3e-07 >ref|NP_191327.4| Peptidase S41 family protein [Arabidopsis thaliana] gi|332646165|gb|AEE79686.1| Peptidase S41 family protein [Arabidopsis thaliana] Length = 519 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -2 Query: 118 EYQSFRIGSDGNVQGVGLFVNTEPKTGHLLI 26 EYQSFRIGSDGN+QGVGLF+N+EP+TGHL++ Sbjct: 185 EYQSFRIGSDGNLQGVGLFINSEPRTGHLVV 215 >ref|XP_002526736.1| protease, putative [Ricinus communis] gi|223533925|gb|EEF35650.1| protease, putative [Ricinus communis] Length = 414 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 118 EYQSFRIGSDGNVQGVGLFVNTEPKTGHLLI 26 EYQSFRIGSDGN+QGVG+F+N EPKTGHL++ Sbjct: 111 EYQSFRIGSDGNLQGVGIFINVEPKTGHLVV 141 >ref|XP_002876431.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata] gi|297322269|gb|EFH52690.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata] Length = 517 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 118 EYQSFRIGSDGNVQGVGLFVNTEPKTGHLLI 26 EYQSFRIGSDGN QGVGLF+N+EP+TGHL++ Sbjct: 183 EYQSFRIGSDGNFQGVGLFINSEPRTGHLVV 213 >emb|CAB41187.1| carboxyl terminal protease-like protein [Arabidopsis thaliana] Length = 519 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -2 Query: 118 EYQSFRIGSDGNVQGVGLFVNTEPKTGHLLINDGQID 8 EYQSFRIGSDGN+QGVGLF+N+EP+TGHL+ + ++ Sbjct: 153 EYQSFRIGSDGNLQGVGLFINSEPRTGHLVSDQTHLE 189 >ref|XP_002277512.2| PREDICTED: carboxyl-terminal-processing protease-like [Vitis vinifera] Length = 520 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -2 Query: 118 EYQSFRIGSDGNVQGVGLFVNTEPKTGHLLI 26 EYQ+FRIGSDGN+QGVG+F+N EP+TGHL++ Sbjct: 187 EYQNFRIGSDGNLQGVGIFINAEPRTGHLIV 217