BLASTX nr result
ID: Atractylodes21_contig00031038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031038 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537017.1| PREDICTED: structural maintenance of chromos... 87 2e-15 ref|XP_003542420.1| PREDICTED: structural maintenance of chromos... 86 3e-15 ref|XP_002273034.2| PREDICTED: structural maintenance of chromos... 82 5e-14 emb|CBI37123.3| unnamed protein product [Vitis vinifera] 82 5e-14 emb|CAD59409.1| SMC1 protein [Oryza sativa] 81 8e-14 >ref|XP_003537017.1| PREDICTED: structural maintenance of chromosomes protein 1A-like [Glycine max] Length = 1216 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = +3 Query: 3 QELLEGNGFQSIVISLKDSFYNKADALVGVYRDSERGCSRALTFNLTKYRK 155 Q++ GNGFQSIVISLKD+FY+KA+ALVGVYRDSERGCSR LTF+LTKYR+ Sbjct: 1165 QDVDGGNGFQSIVISLKDTFYDKAEALVGVYRDSERGCSRTLTFDLTKYRE 1215 >ref|XP_003542420.1| PREDICTED: structural maintenance of chromosomes protein 1A-like [Glycine max] Length = 1216 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 18 GNGFQSIVISLKDSFYNKADALVGVYRDSERGCSRALTFNLTKYRK 155 GNGFQSIVISLKD+FY+KA+ALVGVYRDSERGCSR LTF+LTKYR+ Sbjct: 1170 GNGFQSIVISLKDTFYDKAEALVGVYRDSERGCSRTLTFDLTKYRE 1215 >ref|XP_002273034.2| PREDICTED: structural maintenance of chromosomes protein 1A-like [Vitis vinifera] Length = 1309 Score = 82.0 bits (201), Expect = 5e-14 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = +3 Query: 18 GNGFQSIVISLKDSFYNKADALVGVYRDSERGCSRALTFNLTKYRK 155 G+GFQSIVISLKDSFY+KA+ALVGVYRDS+RGCSR LTF+LT YR+ Sbjct: 1263 GSGFQSIVISLKDSFYDKAEALVGVYRDSDRGCSRTLTFDLTNYRE 1308 >emb|CBI37123.3| unnamed protein product [Vitis vinifera] Length = 2295 Score = 82.0 bits (201), Expect = 5e-14 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = +3 Query: 18 GNGFQSIVISLKDSFYNKADALVGVYRDSERGCSRALTFNLTKYRK 155 G+GFQSIVISLKDSFY+KA+ALVGVYRDS+RGCSR LTF+LT YR+ Sbjct: 2249 GSGFQSIVISLKDSFYDKAEALVGVYRDSDRGCSRTLTFDLTNYRE 2294 >emb|CAD59409.1| SMC1 protein [Oryza sativa] Length = 1264 Score = 81.3 bits (199), Expect = 8e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +3 Query: 18 GNGFQSIVISLKDSFYNKADALVGVYRDSERGCSRALTFNLTKYRK 155 G GFQSIVISLKDSFY+KA+ALVGVYRDSER CSR LTF+LTKYR+ Sbjct: 1218 GCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRE 1263