BLASTX nr result
ID: Atractylodes21_contig00031023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031023 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum ... 50 7e-09 emb|CAN72676.1| hypothetical protein VITISV_020406 [Vitis vinifera] 49 6e-07 emb|CAN60238.1| hypothetical protein VITISV_032906 [Vitis vinifera] 49 1e-06 emb|CAN71759.1| hypothetical protein VITISV_020777 [Vitis vinifera] 48 2e-06 >gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1333 Score = 50.1 bits (118), Expect(2) = 7e-09 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 48 FWSLR*WQSEDEIFV-QRKYAANLLKKFNLANCEISTPLMNINERFQ 185 F L Q +D IF+ Q+KYA +LLKKF + NCE++T MNINE+ Q Sbjct: 1049 FLGLEVIQDKDGIFISQKKYAEDLLKKFQMMNCEVATTPMNINEKLQ 1095 Score = 34.7 bits (78), Expect(2) = 7e-09 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +2 Query: 2 MMRKFEITDLHLLKYFLELEVM 67 MMR FE++DL LLKYFL LEV+ Sbjct: 1034 MMRNFEMSDLGLLKYFLGLEVI 1055 >emb|CAN72676.1| hypothetical protein VITISV_020406 [Vitis vinifera] Length = 1183 Score = 49.3 bits (116), Expect(2) = 6e-07 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +3 Query: 42 NIFWSLR*WQSEDEIFV-QRKYAANLLKKFNLANCEISTPLMNINERFQHE 191 + F L Q ED +FV QRKYA +LLKKFN+ NC++ MN NE+ Q E Sbjct: 896 HFFLGLEVKQVEDGVFVSQRKYAVDLLKKFNMLNCKVVATPMNSNEKLQAE 946 Score = 28.9 bits (63), Expect(2) = 6e-07 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 2 MMRKFEITDLHLLKYFLELEV 64 M +KFE++DL LL +FL LEV Sbjct: 883 MKKKFEMSDLGLLHFFLGLEV 903 >emb|CAN60238.1| hypothetical protein VITISV_032906 [Vitis vinifera] Length = 1430 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +3 Query: 42 NIFWSLR*WQSEDEIFV-QRKYAANLLKKFNLANCEISTPLMNINERFQHE 191 + F L Q ED +FV QRKYA +LLKKFN+ NC++ MN NE+ Q E Sbjct: 1147 HFFLGLEVKQVEDGVFVSQRKYAVDLLKKFNMLNCKVVAIPMNSNEKLQAE 1197 Score = 28.9 bits (63), Expect(2) = 1e-06 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +2 Query: 2 MMRKFEITDLHLLKYFLELEV 64 M +KFE++DL LL +FL LEV Sbjct: 1134 MKKKFEMSDLGLLHFFLGLEV 1154 >emb|CAN71759.1| hypothetical protein VITISV_020777 [Vitis vinifera] Length = 1472 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 25/51 (49%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = +3 Query: 42 NIFWSLR*WQSEDEIFV-QRKYAANLLKKFNLANCEISTPLMNINERFQHE 191 + F L Q ED +FV QRKY +LLKKFN+ NC++ MN NE+ Q E Sbjct: 976 HFFLXLEVKQVEDGVFVSQRKYXVDLLKKFNMLNCKVVATXMNSNEKLQAE 1026 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 2 MMRKFEITDLHLLKYFLELEV 64 M +KFE+++L LL +FL LEV Sbjct: 963 MKKKFEMSBLGLLHFFLXLEV 983