BLASTX nr result
ID: Atractylodes21_contig00029405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029405 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532505.1| 40S ribosomal protein S11, putative [Ricinus... 61 8e-08 gb|AFX66997.1| 40s ribosomal protein S11 [Solanum tuberosum] 60 2e-07 ref|XP_004138716.1| PREDICTED: 40S ribosomal protein S11-3-like ... 58 7e-07 ref|XP_002325170.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002327018.1| predicted protein [Populus trichocarpa] gi|1... 57 1e-06 >ref|XP_002532505.1| 40S ribosomal protein S11, putative [Ricinus communis] gi|223527780|gb|EEF29881.1| 40S ribosomal protein S11, putative [Ricinus communis] Length = 159 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 91 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >gb|AFX66997.1| 40s ribosomal protein S11 [Solanum tuberosum] Length = 159 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 91 RPLSKTVRFNVLKVIPAGS GGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSGGGGKKAFTGM 159 >ref|XP_004138716.1| PREDICTED: 40S ribosomal protein S11-3-like isoform 2 [Cucumis sativus] gi|449493335|ref|XP_004159259.1| PREDICTED: 40S ribosomal protein S11-3-like isoform 2 [Cucumis sativus] Length = 159 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 2 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 91 RPLSKTVRFNVLKVIPAGSS GGKKAF GI Sbjct: 130 RPLSKTVRFNVLKVIPAGSSAGGKKAFAGI 159 >ref|XP_002325170.1| predicted protein [Populus trichocarpa] gi|222866604|gb|EEF03735.1| predicted protein [Populus trichocarpa] Length = 159 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 2 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 91 RPLSKTVRFNVLKVIPAGS+ GGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSAAGGKKAFTGM 159 >ref|XP_002327018.1| predicted protein [Populus trichocarpa] gi|118481533|gb|ABK92709.1| unknown [Populus trichocarpa] gi|222835333|gb|EEE73768.1| predicted protein [Populus trichocarpa] Length = 159 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 91 RPLSKTVRFNVLKVIPAGSSGG KK FTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGAKKVFTGM 159