BLASTX nr result
ID: Atractylodes21_contig00029392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029392 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520678.1| hypothetical protein RCOM_0555710 [Ricinus c... 62 4e-08 ref|XP_003625866.1| CONSTANS-like zinc finger protein [Medicago ... 59 4e-07 ref|XP_002320650.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 gb|ADV56685.1| CCT motif protein [Phaseolus vulgaris] 57 1e-06 ref|XP_002880330.1| zinc finger (B-box type) family protein [Ara... 56 3e-06 >ref|XP_002520678.1| hypothetical protein RCOM_0555710 [Ricinus communis] gi|223540063|gb|EEF41640.1| hypothetical protein RCOM_0555710 [Ricinus communis] Length = 411 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 419 RYDKHIRYESRKVRAESRTRIRGRFAKMDR 330 RYDKHIRYESRK RAESRTRIRGRFAKMDR Sbjct: 382 RYDKHIRYESRKARAESRTRIRGRFAKMDR 411 >ref|XP_003625866.1| CONSTANS-like zinc finger protein [Medicago truncatula] gi|355500881|gb|AES82084.1| CONSTANS-like zinc finger protein [Medicago truncatula] Length = 372 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 419 RYDKHIRYESRKVRAESRTRIRGRFAKMD 333 RYDKHIRYESRKVRAESRTR++GRFAK+D Sbjct: 343 RYDKHIRYESRKVRAESRTRVKGRFAKID 371 >ref|XP_002320650.1| predicted protein [Populus trichocarpa] gi|222861423|gb|EEE98965.1| predicted protein [Populus trichocarpa] Length = 124 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 419 RYDKHIRYESRKVRAESRTRIRGRFAKMD 333 RY KHIRYESRKVRAE RTRIRGRFAKMD Sbjct: 95 RYSKHIRYESRKVRAEGRTRIRGRFAKMD 123 >gb|ADV56685.1| CCT motif protein [Phaseolus vulgaris] Length = 391 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 419 RYDKHIRYESRKVRAESRTRIRGRFAKMDR 330 RYDKHIRYESRKVRAESR R++GRFAKM++ Sbjct: 360 RYDKHIRYESRKVRAESRVRVKGRFAKMEQ 389 >ref|XP_002880330.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. lyrata] gi|297326169|gb|EFH56589.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. lyrata] Length = 324 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 419 RYDKHIRYESRKVRAESRTRIRGRFAK 339 RY+KHIRYESRKVRAESRTRIRGRFAK Sbjct: 294 RYEKHIRYESRKVRAESRTRIRGRFAK 320