BLASTX nr result
ID: Atractylodes21_contig00028975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028975 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_567839.1| PA-domain containing subtilase family protein [... 55 8e-06 ref|XP_002269786.1| PREDICTED: subtilisin-like protease [Vitis v... 55 8e-06 >ref|NP_567839.1| PA-domain containing subtilase family protein [Arabidopsis thaliana] gi|4938478|emb|CAB43837.1| proteinase-like protein [Arabidopsis thaliana] gi|7269902|emb|CAB80995.1| AT4g30020 [Arabidopsis thaliana] gi|22655014|gb|AAM98098.1| AT4g30020/F6G3_50 [Arabidopsis thaliana] gi|29028756|gb|AAO64757.1| AT4g30020/F6G3_50 [Arabidopsis thaliana] gi|110740572|dbj|BAE98391.1| hypothetical protein [Arabidopsis thaliana] gi|332660309|gb|AEE85709.1| PA-domain containing subtilase family protein [Arabidopsis thaliana] Length = 816 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = -1 Query: 333 PVISYKGGVNGFEATAVESDEKLDVTRSVFLEYL-SLLLIMNASYKIIFFETGFSSYYTF 157 P+ISYKGG NGFEATAVESDEK+D T + Y L + ++F E + Y++ Sbjct: 30 PIISYKGGDNGFEATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLFVEGSYKKLYSY 89 Query: 156 TILSKSVVAYSSLIQSSFMK 97 L A+ S Q+ ++ Sbjct: 90 KHLINGFAAHVSPDQAEMLR 109 >ref|XP_002269786.1| PREDICTED: subtilisin-like protease [Vitis vinifera] gi|296090288|emb|CBI40107.3| unnamed protein product [Vitis vinifera] Length = 817 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = -1 Query: 333 PVISYKGGVNGFEATAVESDEKLDVTRSVFLEYLSLLLIMNASYKIIFFETG-FSSYYTF 157 PVISYKGGV GFEATAVESDE +DVT + Y L + + + FE G + Y++ Sbjct: 33 PVISYKGGVPGFEATAVESDETIDVTSELVTSYSRHLEMKHDMLLSLLFEHGTYKKLYSY 92 Query: 156 TILSKSVVAYSSLIQSSFMK 97 L + S Q+ ++ Sbjct: 93 RHLINGFAVHISPEQAEVLR 112