BLASTX nr result
ID: Atractylodes21_contig00028964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028964 (162 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328598.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 ref|NP_188295.2| condensin-2 complex subunit H2 [Arabidopsis tha... 67 2e-09 emb|CBI22967.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002270818.1| PREDICTED: condensin-2 complex subunit H2-li... 67 2e-09 ref|XP_002516959.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 >ref|XP_002328598.1| predicted protein [Populus trichocarpa] gi|222838580|gb|EEE76945.1| predicted protein [Populus trichocarpa] Length = 645 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +2 Query: 2 SGGSGELESYLLATNDLYRDFILLDPCDAVTVDEYLGGNDIVSQAKSGFKGES 160 SG GELESYLLATNDLYRDFILL+PCDA+ V+++L +D ++G S Sbjct: 165 SGDGGELESYLLATNDLYRDFILLNPCDAIAVNDFLKADDTRKAQYGSYRGSS 217 >ref|NP_188295.2| condensin-2 complex subunit H2 [Arabidopsis thaliana] gi|75274279|sp|Q9LUR0.1|CNDH2_ARATH RecName: Full=Condensin-2 complex subunit H2; AltName: Full=Chromosome-associated protein H2; Short=AtCAP-H2; AltName: Full=Non-SMC condensin II complex subunit H2; AltName: Full=Protein HYPERSENSITIVE TO EXCESS BORON 2; Short=Hypersensitive to excess B 2 gi|11994628|dbj|BAB02765.1| unnamed protein product [Arabidopsis thaliana] gi|62533249|dbj|BAD95574.1| chromosoma associate protein subunit H2 [Arabidopsis thaliana] gi|110741945|dbj|BAE98913.1| hypothetical protein [Arabidopsis thaliana] gi|332642337|gb|AEE75858.1| condensin-2 complex subunit H2 [Arabidopsis thaliana] Length = 683 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/53 (64%), Positives = 37/53 (69%) Frame = +2 Query: 2 SGGSGELESYLLATNDLYRDFILLDPCDAVTVDEYLGGNDIVSQAKSGFKGES 160 SG GELESYLLAT LYRDFILLDPCDAV V+E+LG N S +G S Sbjct: 169 SGDGGELESYLLATTHLYRDFILLDPCDAVAVNEFLGDNYGGKGRNSAHRGSS 221 >emb|CBI22967.3| unnamed protein product [Vitis vinifera] Length = 1281 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 2 SGGSGELESYLLATNDLYRDFILLDPCDAVTVDEYLGGN 118 +G GEL+SYLLATNDLYRDFILLDPCDAV VD +L G+ Sbjct: 768 TGDGGELDSYLLATNDLYRDFILLDPCDAVAVDSFLKGD 806 >ref|XP_002270818.1| PREDICTED: condensin-2 complex subunit H2-like [Vitis vinifera] Length = 666 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 2 SGGSGELESYLLATNDLYRDFILLDPCDAVTVDEYLGGN 118 +G GEL+SYLLATNDLYRDFILLDPCDAV VD +L G+ Sbjct: 168 TGDGGELDSYLLATNDLYRDFILLDPCDAVAVDSFLKGD 206 >ref|XP_002516959.1| conserved hypothetical protein [Ricinus communis] gi|223544047|gb|EEF45573.1| conserved hypothetical protein [Ricinus communis] Length = 667 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = +2 Query: 2 SGGSGELESYLLATNDLYRDFILLDPCDAVTVDEYLGGNDIVSQAKSGFKGES 160 +G GEL+SYLLATNDLYRDFILLDPCDA V+++ G++ S KG S Sbjct: 166 TGDGGELDSYLLATNDLYRDFILLDPCDADAVNDFFNGDETGKGLNSTCKGSS 218