BLASTX nr result
ID: Atractylodes21_contig00028900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00028900 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606393.1| YrdC domain-containing protein [Medicago tru... 119 3e-25 ref|XP_003538209.1| PREDICTED: yrdC domain-containing protein, m... 117 8e-25 ref|XP_002530287.1| Protein SUA5, putative [Ricinus communis] gi... 117 1e-24 ref|XP_002285123.1| PREDICTED: yrdC domain-containing protein, m... 115 3e-24 emb|CAN77236.1| hypothetical protein VITISV_024209 [Vitis vinifera] 115 3e-24 >ref|XP_003606393.1| YrdC domain-containing protein [Medicago truncatula] gi|355507448|gb|AES88590.1| YrdC domain-containing protein [Medicago truncatula] Length = 462 Score = 119 bits (297), Expect = 3e-25 Identities = 59/75 (78%), Positives = 61/75 (81%) Frame = +2 Query: 2 GKVIAVPTDTLYGFACDACSVEAVNRIYEIKGRKHTSPLAICVGDVSDIGRFAVTDHXXX 181 GKVIAVPTDTLYGFACDACS+EAVNRIYEIKGRKHTSPLAICVGDVSDI RFA+TDH Sbjct: 37 GKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKHTSPLAICVGDVSDINRFALTDHLPH 96 Query: 182 XXXXXXXXXXVTVVL 226 VTVVL Sbjct: 97 GLLDSLLPGPVTVVL 111 >ref|XP_003538209.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like [Glycine max] Length = 290 Score = 117 bits (294), Expect = 8e-25 Identities = 58/75 (77%), Positives = 61/75 (81%) Frame = +2 Query: 2 GKVIAVPTDTLYGFACDACSVEAVNRIYEIKGRKHTSPLAICVGDVSDIGRFAVTDHXXX 181 GKVIAVPTDTLYGFACDACS+EAVNRIYEIKGR+HTSP+AICVGDVSDI RFAVTDH Sbjct: 96 GKVIAVPTDTLYGFACDACSMEAVNRIYEIKGRRHTSPVAICVGDVSDIARFAVTDHLPH 155 Query: 182 XXXXXXXXXXVTVVL 226 VTVVL Sbjct: 156 GLLDSLLPGPVTVVL 170 >ref|XP_002530287.1| Protein SUA5, putative [Ricinus communis] gi|223530185|gb|EEF32094.1| Protein SUA5, putative [Ricinus communis] Length = 233 Score = 117 bits (292), Expect = 1e-24 Identities = 58/75 (77%), Positives = 60/75 (80%) Frame = +2 Query: 2 GKVIAVPTDTLYGFACDACSVEAVNRIYEIKGRKHTSPLAICVGDVSDIGRFAVTDHXXX 181 GKVIAVPTDTLYGFACDACS+EAVNRIYEIKGRKHTSPLAIC+GDVSDI FAVTDH Sbjct: 38 GKVIAVPTDTLYGFACDACSLEAVNRIYEIKGRKHTSPLAICIGDVSDIKHFAVTDHLPN 97 Query: 182 XXXXXXXXXXVTVVL 226 VTVVL Sbjct: 98 GLLDSLLPGAVTVVL 112 >ref|XP_002285123.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Vitis vinifera] gi|297746251|emb|CBI16307.3| unnamed protein product [Vitis vinifera] Length = 272 Score = 115 bits (289), Expect = 3e-24 Identities = 59/75 (78%), Positives = 59/75 (78%) Frame = +2 Query: 2 GKVIAVPTDTLYGFACDACSVEAVNRIYEIKGRKHTSPLAICVGDVSDIGRFAVTDHXXX 181 GKVIAVPTDTLYGFACDACS EAVNRIYEIKGRKHTSPLAICVGDV DI RFAVTDH Sbjct: 77 GKVIAVPTDTLYGFACDACSSEAVNRIYEIKGRKHTSPLAICVGDVLDIQRFAVTDHLPD 136 Query: 182 XXXXXXXXXXVTVVL 226 VTVVL Sbjct: 137 GLLGSLLPGPVTVVL 151 >emb|CAN77236.1| hypothetical protein VITISV_024209 [Vitis vinifera] Length = 750 Score = 115 bits (289), Expect = 3e-24 Identities = 59/75 (78%), Positives = 59/75 (78%) Frame = +2 Query: 2 GKVIAVPTDTLYGFACDACSVEAVNRIYEIKGRKHTSPLAICVGDVSDIGRFAVTDHXXX 181 GKVIAVPTDTLYGFACDACS EAVNRIYEIKGRKHTSPLAICVGDV DI RFAVTDH Sbjct: 630 GKVIAVPTDTLYGFACDACSSEAVNRIYEIKGRKHTSPLAICVGDVLDIQRFAVTDHLPD 689 Query: 182 XXXXXXXXXXVTVVL 226 VTVVL Sbjct: 690 GLLGSLLPGPVTVVL 704