BLASTX nr result
ID: Atractylodes21_contig00027361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027361 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514952.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002514952.1| conserved hypothetical protein [Ricinus communis] gi|223546003|gb|EEF47506.1| conserved hypothetical protein [Ricinus communis] Length = 1059 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = -1 Query: 228 SYTXXXXXXXXXSPLTSIITDTSRVSSGSKGRQWFPKG--GRSIARYQLLREVWKDGE 61 SYT SPLTSII D SRVS S W PKG GR + RYQLLR++WKDGE Sbjct: 1002 SYTSDDELDELDSPLTSIIIDNSRVSPASTASNWTPKGKGGRKVVRYQLLRQIWKDGE 1059