BLASTX nr result
ID: Atractylodes21_contig00027358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027358 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003522391.1| PREDICTED: uncharacterized protein LOC100803... 55 6e-06 >ref|XP_003522391.1| PREDICTED: uncharacterized protein LOC100803280 [Glycine max] Length = 473 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/59 (50%), Positives = 39/59 (66%), Gaps = 5/59 (8%) Frame = +1 Query: 256 IIFTFVSILLLFVPVAVS-----LPKNETAFRPVQELKKLKRIRTHLKKINKPSVKTIQ 417 ++ FV++LLL +A + L + FRP EL KL+R+R HLKKINKPSVKTIQ Sbjct: 66 VLPAFVALLLLVTSIAPAALCHPLQGSNHTFRPNHELLKLRRVRAHLKKINKPSVKTIQ 124