BLASTX nr result
ID: Atractylodes21_contig00027257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027257 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522671.1| transcription factor, putative [Ricinus comm... 55 6e-06 >ref|XP_002522671.1| transcription factor, putative [Ricinus communis] gi|223538147|gb|EEF39758.1| transcription factor, putative [Ricinus communis] Length = 422 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = -1 Query: 434 YKLNPTDSDMIKYLKHKIESENFSQPRWRVHEVDDFCDYNPQELSERYDAARDGNWYFIT 255 Y+ P D +++ YLKHKIE F P +H+VD + ++PQEL+ Y+ + WYF T Sbjct: 136 YRFMPNDEELVNYLKHKIEG--FPLPLGLIHDVDIY-KFHPQELTGEYELIGEREWYFFT 192 Query: 254 P 252 P Sbjct: 193 P 193