BLASTX nr result
ID: Atractylodes21_contig00027027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00027027 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634751.1| PREDICTED: uncharacterized protein LOC100232... 62 6e-08 ref|XP_003634746.1| PREDICTED: probable glutathione S-transferas... 62 6e-08 ref|XP_002265227.2| PREDICTED: glutathione S-transferase U25-lik... 61 8e-08 ref|XP_002515772.1| glutathione s-transferase, putative [Ricinus... 61 8e-08 ref|XP_002532823.1| glutathione s-transferase, putative [Ricinus... 61 8e-08 >ref|XP_003634751.1| PREDICTED: uncharacterized protein LOC100232878 [Vitis vinifera] Length = 219 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 154 EELVLLDFWASMFGMRVRIALAEKGIPYEYREE 252 +E++LLDFW SMFGMRVR+ALAEKG+ YEYREE Sbjct: 3 DEIILLDFWPSMFGMRVRVALAEKGLKYEYREE 35 >ref|XP_003634746.1| PREDICTED: probable glutathione S-transferase parC-like isoform 2 [Vitis vinifera] Length = 219 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 154 EELVLLDFWASMFGMRVRIALAEKGIPYEYREE 252 +E++LLDFW SMFGMRVR+ALAEKG+ YEYREE Sbjct: 3 DEIILLDFWPSMFGMRVRVALAEKGLKYEYREE 35 >ref|XP_002265227.2| PREDICTED: glutathione S-transferase U25-like isoform 2 [Vitis vinifera] Length = 139 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 154 EELVLLDFWASMFGMRVRIALAEKGIPYEYREE 252 +E++LLDFW SMFGMRVR+ALAEKG+ YEYREE Sbjct: 3 DEIILLDFWPSMFGMRVRLALAEKGLKYEYREE 35 >ref|XP_002515772.1| glutathione s-transferase, putative [Ricinus communis] gi|223545100|gb|EEF46611.1| glutathione s-transferase, putative [Ricinus communis] Length = 214 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 142 MAKPEELVLLDFWASMFGMRVRIALAEKGIPYEYREE 252 MA+ +++VLLDFW S FGMRVRIALAEKGI YEYR+E Sbjct: 1 MAQDDQVVLLDFWPSPFGMRVRIALAEKGIKYEYRDE 37 >ref|XP_002532823.1| glutathione s-transferase, putative [Ricinus communis] gi|223527414|gb|EEF29553.1| glutathione s-transferase, putative [Ricinus communis] Length = 219 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 154 EELVLLDFWASMFGMRVRIALAEKGIPYEYREE 252 +E++LLDFWAS FGMRVRIALAEKG+ YEYREE Sbjct: 3 DEVILLDFWASPFGMRVRIALAEKGVKYEYREE 35