BLASTX nr result
ID: Atractylodes21_contig00025624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025624 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869960.1| hypothetical protein ARALYDRAFT_354764 [Arab... 56 3e-06 >ref|XP_002869960.1| hypothetical protein ARALYDRAFT_354764 [Arabidopsis lyrata subsp. lyrata] gi|297315796|gb|EFH46219.1| hypothetical protein ARALYDRAFT_354764 [Arabidopsis lyrata subsp. lyrata] Length = 644 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = -1 Query: 205 LPFFLCKCLDE--RRRDFIDTCVPLYEASIKGDWGAAEAILLNNRDLVRYSITSHCDTAL 32 L F+LC+ + RRR+ +D V LY+A++KGDW AA+ + D+VR I S+ + AL Sbjct: 68 LRFYLCEEAKQEARRREKLDRGVQLYQATLKGDWNAAKTRIDEQEDIVRQEINSNSEIAL 127 Query: 31 HLAASAQ 11 H+A +A+ Sbjct: 128 HIAVAAK 134