BLASTX nr result
ID: Atractylodes21_contig00025557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025557 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534597.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002534597.1| conserved hypothetical protein [Ricinus communis] gi|223524949|gb|EEF27784.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/59 (57%), Positives = 41/59 (69%) Frame = +2 Query: 23 LQNDIQERQRGLNFLLRSVRTQDPARREARIRPTREHIEYLEGR*QALRAEHQALIVQA 199 L+N+I+ER+R LN LR+VR +DPA E RI RE+I LE R Q LR E Q LIVQA Sbjct: 19 LKNEIKERRRALNLFLRNVRARDPAEAERRIGAARENIRDLERRLQVLRKEQQELIVQA 77