BLASTX nr result
ID: Atractylodes21_contig00025129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00025129 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP49331.1| non-specific lipid-transfer protein type 2, parti... 62 9e-08 ref|XP_003528957.1| PREDICTED: probable non-specific lipid-trans... 59 4e-07 gb|ACI26699.1| lipid transfer protein [Gossypium hirsutum] 59 4e-07 ref|XP_002527025.1| Nonspecific lipid-transfer protein, putative... 59 7e-07 dbj|BAA25680.1| Lipid transfer protein [Brassica rapa] 58 1e-06 >gb|AFP49331.1| non-specific lipid-transfer protein type 2, partial [Olea europaea] Length = 82 Score = 61.6 bits (148), Expect = 9e-08 Identities = 29/59 (49%), Positives = 38/59 (64%) Frame = -1 Query: 509 LLFTGHLQLTEAQATCDPVEISWCLQAIVSNMKPSDDCCKKLKGQEPCLCRETTDPTFG 333 +L G L ++EA TC+P+++S CL AI S PS CCKKL+ Q+PCLC DP G Sbjct: 3 VLLLGELHVSEA-VTCNPLQLSPCLGAITSGQPPSAACCKKLQEQKPCLCGYIKDPNLG 60 >ref|XP_003528957.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like [Glycine max] Length = 93 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = -1 Query: 509 LLFTGHLQLTEAQATCDPVEISWCLQAIVSNMKPSDDCCKKLKGQEPCLCRETTDP 342 LLF +Q+++A TC PV++S C+ AI S+ PS+ CC K+K Q+PCLC+ +P Sbjct: 14 LLFVAEVQVSKA-VTCSPVQLSACVSAITSSTPPSNLCCSKIKEQKPCLCQYLKNP 68 >gb|ACI26699.1| lipid transfer protein [Gossypium hirsutum] Length = 111 Score = 59.3 bits (142), Expect = 4e-07 Identities = 23/55 (41%), Positives = 35/55 (63%) Frame = -1 Query: 503 FTGHLQLTEAQATCDPVEISWCLQAIVSNMKPSDDCCKKLKGQEPCLCRETTDPT 339 F+G + EA TC+P+E+ CL A++S+ PS+ CC +L+ Q PC C DP+ Sbjct: 33 FSGETRWAEAAVTCNPIELIPCLAAVMSSTPPSETCCSRLREQTPCFCGYLNDPS 87 >ref|XP_002527025.1| Nonspecific lipid-transfer protein, putative [Ricinus communis] gi|223533660|gb|EEF35397.1| Nonspecific lipid-transfer protein, putative [Ricinus communis] Length = 91 Score = 58.5 bits (140), Expect = 7e-07 Identities = 29/56 (51%), Positives = 35/56 (62%) Frame = -1 Query: 509 LLFTGHLQLTEAQATCDPVEISWCLQAIVSNMKPSDDCCKKLKGQEPCLCRETTDP 342 LL +Q+T A TCDPVE+S C AI S+ PS CC KLK Q PCLC+ +P Sbjct: 12 LLLGETVQVTSA-VTCDPVELSACANAITSSSPPSAICCSKLKQQRPCLCQYVKNP 66 >dbj|BAA25680.1| Lipid transfer protein [Brassica rapa] Length = 86 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = -1 Query: 482 TEAQATCDPVEISWCLQAIVSNMKPSDDCCKKLKGQEPCLCRETTDPTF 336 T +A CDP ++ CL AI +PS DCC KLK Q+PCLC + +P F Sbjct: 15 TNVEAACDPKQLQPCLAAITGGGQPSGDCCAKLKEQQPCLCGFSKNPAF 63