BLASTX nr result
ID: Atractylodes21_contig00024946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024946 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608910.1| hypothetical protein MTR_4g104330 [Medicago ... 55 6e-06 >ref|XP_003608910.1| hypothetical protein MTR_4g104330 [Medicago truncatula] gi|355509965|gb|AES91107.1| hypothetical protein MTR_4g104330 [Medicago truncatula] Length = 111 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%) Frame = +3 Query: 87 NGWKLDGKGDFLVKTLRRLLEDKLLSSPQHPVDFKWCKLVPRKINIFMWRLRKGGIPVRQ 266 +GW LD G + V+ +L ++ S H VD W K VP K+++F+WRL + +P + Sbjct: 7 SGWLLDPSGGYSVRGAYAMLTEQETSQDMHDVDLIWHKHVPLKVSVFVWRLLRDCLPTKS 66 Query: 267 MLHDRG-IDVESRLC 308 L RG +D ++ LC Sbjct: 67 NLVTRGALDSKAFLC 81