BLASTX nr result
ID: Atractylodes21_contig00024729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024729 (598 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 ref|XP_003631269.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 55 9e-06 emb|CBI28530.3| unnamed protein product [Vitis vinifera] 55 9e-06 >ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] gi|449477571|ref|XP_004155060.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] Length = 487 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/39 (71%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -2 Query: 597 QMIEEGLMLERKFY-NLIGILCGVKRESYALELFELMKK 484 +MIEEGL +RKFY +LIGILCGV+R +YALELFE MK+ Sbjct: 358 EMIEEGLTPDRKFYYDLIGILCGVERTNYALELFEKMKR 396 >ref|XP_003631269.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Vitis vinifera] Length = 505 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/39 (66%), Positives = 35/39 (89%), Gaps = 1/39 (2%) Frame = -2 Query: 597 QMIEEGLMLERKFY-NLIGILCGVKRESYALELFELMKK 484 +MIEEGL+ +RKFY +LIG+LCGV+R +YALE+FE MK+ Sbjct: 348 EMIEEGLVPDRKFYYDLIGVLCGVERVNYALEMFERMKR 386 >emb|CBI28530.3| unnamed protein product [Vitis vinifera] Length = 452 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/39 (66%), Positives = 35/39 (89%), Gaps = 1/39 (2%) Frame = -2 Query: 597 QMIEEGLMLERKFY-NLIGILCGVKRESYALELFELMKK 484 +MIEEGL+ +RKFY +LIG+LCGV+R +YALE+FE MK+ Sbjct: 317 EMIEEGLVPDRKFYYDLIGVLCGVERVNYALEMFERMKR 355