BLASTX nr result
ID: Atractylodes21_contig00024546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024546 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531275.1| ATP binding protein, putative [Ricinus commu... 55 6e-06 >ref|XP_002531275.1| ATP binding protein, putative [Ricinus communis] gi|223529108|gb|EEF31088.1| ATP binding protein, putative [Ricinus communis] Length = 842 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/64 (43%), Positives = 39/64 (60%) Frame = -3 Query: 212 MVDSSISGTILPNCLRRFAQIANRCLYSVPKERPSMTEVVASLQVLLELQGKNDDSGESS 33 ++D I G I P CL++FA A +CL ERPSM +V+ +L+ L+LQ +D SG S Sbjct: 753 IIDPLIKGKIKPECLKKFADTAEKCLSEAGIERPSMGDVLWNLEFALQLQQSSDSSGYSI 812 Query: 32 GIMG 21 I G Sbjct: 813 QIDG 816