BLASTX nr result
ID: Atractylodes21_contig00024535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024535 (1128 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264137.1| PREDICTED: uncharacterized protein LOC100262... 64 7e-08 ref|XP_003534719.1| PREDICTED: uncharacterized protein LOC100805... 62 2e-07 ref|XP_002317140.1| predicted protein [Populus trichocarpa] gi|2... 62 2e-07 ref|XP_003547265.1| PREDICTED: uncharacterized protein LOC100800... 62 3e-07 ref|XP_002518435.1| conserved hypothetical protein [Ricinus comm... 62 3e-07 >ref|XP_002264137.1| PREDICTED: uncharacterized protein LOC100262450 [Vitis vinifera] gi|302144098|emb|CBI23203.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 63.9 bits (154), Expect = 7e-08 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +2 Query: 623 EWIALVRSHAKAVAYDDIVFPVFKKFWKRRSPLDASKGKHNLTLQSR 763 +WI+LVRSHA+ + D ++F VFKKF KRR P+DA KGK N+ LQ + Sbjct: 211 QWISLVRSHAEVIVDDQVIFSVFKKFCKRRPPIDARKGKQNIKLQKQ 257 >ref|XP_003534719.1| PREDICTED: uncharacterized protein LOC100805897 [Glycine max] Length = 377 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +2 Query: 623 EWIALVRSHAKAVAYDDIVFPVFKKFWKRRSPLDASKGKHNLTLQSR 763 +WI +VR HA+ V DD++F VFKK+ KRR P+D SKGK NL LQ + Sbjct: 208 QWITVVRKHAEVVVDDDVIFSVFKKYCKRRPPIDTSKGKLNLKLQKQ 254 >ref|XP_002317140.1| predicted protein [Populus trichocarpa] gi|222860205|gb|EEE97752.1| predicted protein [Populus trichocarpa] Length = 386 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +2 Query: 623 EWIALVRSHAKAVAYDDIVFPVFKKFWKRRSPLDASKGKHNLTLQSR 763 +WIAL+RSHA+ + D ++ PVFKK KRR PLDA+KGK N+ LQ + Sbjct: 215 QWIALIRSHAEVIVDDVVILPVFKKLCKRRPPLDATKGKLNIKLQKQ 261 >ref|XP_003547265.1| PREDICTED: uncharacterized protein LOC100800690 [Glycine max] Length = 360 Score = 62.0 bits (149), Expect = 3e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +2 Query: 623 EWIALVRSHAKAVAYDDIVFPVFKKFWKRRSPLDASKGKHNLTLQSR 763 +WI +VR HA+ + DD++F VFKK+ KRR P+D SKGK NL LQ + Sbjct: 191 QWITVVRKHAEVIVDDDVIFSVFKKYCKRRPPIDTSKGKLNLKLQKQ 237 >ref|XP_002518435.1| conserved hypothetical protein [Ricinus communis] gi|223542280|gb|EEF43822.1| conserved hypothetical protein [Ricinus communis] Length = 405 Score = 62.0 bits (149), Expect = 3e-07 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +2 Query: 623 EWIALVRSHAKAVAYDDIVFPVFKKFWKRRSPLDASKGKHNLTLQSR 763 +WI L+RSHA+ + D+++FP F+K+ KRR PLDASKGK N LQ + Sbjct: 236 QWITLIRSHAEVIVDDEVIFPEFQKYCKRRLPLDASKGKLNAKLQKQ 282