BLASTX nr result
ID: Atractylodes21_contig00024328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024328 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] 42 7e-07 >emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] Length = 2232 Score = 42.0 bits (97), Expect(2) = 7e-07 Identities = 21/48 (43%), Positives = 31/48 (64%) Frame = +1 Query: 85 RQFVKLAASLENIHDEVL*NHFINGLNPGIRSELRIFEAEGLGQAMEL 228 R+F L L+ I +EV+ + F+NGL P IR+E R+ + GLG ME+ Sbjct: 869 REFEILETPLKGISEEVMESTFMNGLLPEIRAEQRLLQPYGLGHLMEM 916 Score = 35.8 bits (81), Expect(2) = 7e-07 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +3 Query: 3 KMILKHFRSSSDGSLCEQFLVLRQTGT 83 + +L FR + +GSLCEQFL +RQ GT Sbjct: 837 RRLLLRFRLTQEGSLCEQFLAVRQQGT 863