BLASTX nr result
ID: Atractylodes21_contig00024182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00024182 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Vitis vinifera] Length = 728 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/80 (38%), Positives = 42/80 (52%) Frame = -3 Query: 242 SQYPEYAISVLGLILKSGFXXXXXXXXXXXXXLCRKNKVDDAIGLFRGASGYGVAPDEVT 63 +Q P+ V+GL+LK GF LCR V +A+GL R V+PD V+ Sbjct: 122 AQKPQLGFGVVGLVLKRGFTVNVFIMNIVLKGLCRNGGVFEAMGLIREMGRKSVSPDIVS 181 Query: 62 VRTLVSGLCKTSKCLEALAL 3 TL++GLCK K EA+ L Sbjct: 182 YNTLINGLCKAKKLKEAVGL 201