BLASTX nr result
ID: Atractylodes21_contig00022028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022028 (477 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626934.1| hypothetical protein MTR_8g012240 [Medicago ... 66 3e-09 ref|XP_003548628.1| PREDICTED: uncharacterized protein LOC100805... 64 2e-08 ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002533502.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 >ref|XP_003626934.1| hypothetical protein MTR_8g012240 [Medicago truncatula] gi|355520956|gb|AET01410.1| hypothetical protein MTR_8g012240 [Medicago truncatula] Length = 305 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 475 RGLLLPPWRKNRFMQNKWFGPYRRTVNYTPANILSSFPVP-VNHTTSAVQYSLIGFN 308 RGL +PPWRKNR+MQNKWFGPYRRT N N PVP V + S V+ L+GF+ Sbjct: 238 RGLSIPPWRKNRYMQNKWFGPYRRTTNPVHGN-----PVPDVVSSFSGVKCRLVGFD 289 >ref|XP_003548628.1| PREDICTED: uncharacterized protein LOC100805677 [Glycine max] Length = 299 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -3 Query: 475 RGLLLPPWRKNRFMQNKWFGPYRRTVNYTPANILSSFPVP-VNHTTSAVQYSLIGFN 308 RGL LPPWRKNR+MQNKWFGPYRRT N N PVP V S + +GF+ Sbjct: 236 RGLSLPPWRKNRYMQNKWFGPYRRTANPVHGN-----PVPTVVSALSGAKCRFVGFD 287 >ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|222850077|gb|EEE87624.1| predicted protein [Populus trichocarpa] Length = 289 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 475 RGLLLPPWRKNRFMQNKWFGPYRRTVNYTPA 383 R L LPPWRKNR+MQNKWFGPYRRTVN +PA Sbjct: 231 RELSLPPWRKNRYMQNKWFGPYRRTVNPSPA 261 >ref|XP_002533502.1| conserved hypothetical protein [Ricinus communis] gi|223526646|gb|EEF28889.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/55 (52%), Positives = 35/55 (63%) Frame = -3 Query: 475 RGLLLPPWRKNRFMQNKWFGPYRRTVNYTPANILSSFPVPVNHTTSAVQYSLIGF 311 R L LPPWRKNR+MQNKW GPY RT N+ LS+ P + + S V+ L GF Sbjct: 222 RDLSLPPWRKNRYMQNKWLGPYHRTCNHQ----LSANPTMIEASVSVVKCRLFGF 272 >ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|222848523|gb|EEE86070.1| predicted protein [Populus trichocarpa] Length = 289 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/55 (56%), Positives = 36/55 (65%) Frame = -3 Query: 475 RGLLLPPWRKNRFMQNKWFGPYRRTVNYTPANILSSFPVPVNHTTSAVQYSLIGF 311 R L LPPWRKNR+MQNKWFGPY RTVN P N SF P + + V+ +GF Sbjct: 228 RELSLPPWRKNRYMQNKWFGPYLRTVNPLPTN---SFTPP--PSVNVVKCRRVGF 277