BLASTX nr result
ID: Atractylodes21_contig00021586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021586 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA81209.1| NADPH-ferrihemoprotein reductase [Helianthus tub... 61 8e-08 gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana] 60 2e-07 gb|AAB02721.1| NADPH-ferrihemoprotein oxidoreductase, partial [H... 59 5e-07 gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum] 55 5e-06 emb|CAA81210.1| NADPH-ferrihemoprotein reductase [Helianthus tub... 55 5e-06 >emb|CAA81209.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus] Length = 588 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 RSNVAFKKELHTPESYRSCTHLEFDIAHTGL 3 RSNVA KKELHTPES RSCTHLEFDI+HTGL Sbjct: 190 RSNVAVKKELHTPESDRSCTHLEFDISHTGL 220 >gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana] Length = 710 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 RSNVAFKKELHTPESYRSCTHLEFDIAHTGL 3 RSNVAFKKELHT +S RSCTHLEFDI+HTGL Sbjct: 312 RSNVAFKKELHTSQSDRSCTHLEFDISHTGL 342 >gb|AAB02721.1| NADPH-ferrihemoprotein oxidoreductase, partial [Helianthus tuberosus] Length = 238 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 RSNVAFKKELHTPESYRSCTHLEFDIAHTGL 3 RSNVA KKELHTPES RSCTHLEFDI++TGL Sbjct: 5 RSNVAVKKELHTPESDRSCTHLEFDISNTGL 35 >gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum] Length = 710 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 95 RSNVAFKKELHTPESYRSCTHLEFDIAHTGL 3 RSNVA +KELH PES RSCTHLEFDIA TGL Sbjct: 312 RSNVAVRKELHAPESDRSCTHLEFDIAGTGL 342 >emb|CAA81210.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus] Length = 506 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 RSNVAFKKELHTPESYRSCTHLEFDIAHTGL 3 R+NVA KKELH+ ES RSCTHLEFDI+HTGL Sbjct: 108 RANVAVKKELHSSESDRSCTHLEFDISHTGL 138