BLASTX nr result
ID: Atractylodes21_contig00017466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00017466 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171005.1| PREDICTED: LOW QUALITY PROTEIN: TPR repeat-c... 86 3e-15 ref|XP_004146029.1| PREDICTED: TPR repeat-containing thioredoxin... 86 3e-15 ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin... 85 6e-15 ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repea... 85 6e-15 ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin... 83 3e-14 >ref|XP_004171005.1| PREDICTED: LOW QUALITY PROTEIN: TPR repeat-containing thioredoxin TTL1-like [Cucumis sativus] Length = 698 Score = 86.3 bits (212), Expect = 3e-15 Identities = 39/61 (63%), Positives = 50/61 (81%) Frame = +1 Query: 1 NMKFGGEGELVTDLEQFKAAVASSGASVILYKMSSDLQCKQISPFLDTLCTRYPSINFFK 180 N+KFGGE E V+ L+QF+AAV+ G +V+ +K +SDLQCKQISPF+D LC RYPSINF K Sbjct: 589 NLKFGGEVEEVSSLDQFRAAVSFPGVTVVHFKAASDLQCKQISPFVDILCRRYPSINFLK 648 Query: 181 I 183 + Sbjct: 649 V 649 >ref|XP_004146029.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Cucumis sativus] Length = 698 Score = 86.3 bits (212), Expect = 3e-15 Identities = 39/61 (63%), Positives = 50/61 (81%) Frame = +1 Query: 1 NMKFGGEGELVTDLEQFKAAVASSGASVILYKMSSDLQCKQISPFLDTLCTRYPSINFFK 180 N+KFGGE E V+ L+QF+AAV+ G +V+ +K +SDLQCKQISPF+D LC RYPSINF K Sbjct: 589 NLKFGGEVEEVSSLDQFRAAVSFPGVTVVHFKAASDLQCKQISPFVDILCRRYPSINFLK 648 Query: 181 I 183 + Sbjct: 649 V 649 >ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 676 Score = 85.1 bits (209), Expect = 6e-15 Identities = 36/61 (59%), Positives = 53/61 (86%) Frame = +1 Query: 1 NMKFGGEGELVTDLEQFKAAVASSGASVILYKMSSDLQCKQISPFLDTLCTRYPSINFFK 180 N+KFGGE E ++ LEQF+AA++ G SV+L++ +S++QCKQISPF++TLC+R+PSINF K Sbjct: 567 NLKFGGEVEDISGLEQFRAAISLPGVSVVLFETASNMQCKQISPFMNTLCSRHPSINFLK 626 Query: 181 I 183 + Sbjct: 627 V 627 >ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] gi|223536471|gb|EEF38119.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] Length = 640 Score = 85.1 bits (209), Expect = 6e-15 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = +1 Query: 1 NMKFGGEGELVTDLEQFKAAVASSGASVILYKMSSDLQCKQISPFLDTLCTRYPSINFFK 180 NMKFGGE E + LEQF+AA++ G SV+ +K SS+L CKQISPF+D LC RYPSINF K Sbjct: 531 NMKFGGEVEEILGLEQFRAAISLPGVSVVHFKSSSNLHCKQISPFVDALCGRYPSINFLK 590 Query: 181 I 183 + Sbjct: 591 V 591 >ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 692 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/61 (60%), Positives = 51/61 (83%) Frame = +1 Query: 1 NMKFGGEGELVTDLEQFKAAVASSGASVILYKMSSDLQCKQISPFLDTLCTRYPSINFFK 180 N+KFGGE E V+ LEQF+AA++ G SV+ ++++S+ QCKQISPF++TLC RYPSINF K Sbjct: 583 NLKFGGEVEEVSGLEQFRAAISLPGVSVVHFEVASNSQCKQISPFVNTLCGRYPSINFLK 642 Query: 181 I 183 + Sbjct: 643 V 643