BLASTX nr result
ID: Atractylodes21_contig00015661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015661 (662 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG22120.1| polyprotein [Cynara cardunculus var. scolymus] 73 6e-11 emb|CAN83181.1| hypothetical protein VITISV_013310 [Vitis vinifera] 66 5e-09 emb|CAN69205.1| hypothetical protein VITISV_036606 [Vitis vinifera] 65 1e-08 emb|CAN63212.1| hypothetical protein VITISV_002844 [Vitis vinifera] 65 1e-08 emb|CAN66523.1| hypothetical protein VITISV_014781 [Vitis vinifera] 65 1e-08 >gb|ABG22120.1| polyprotein [Cynara cardunculus var. scolymus] Length = 349 Score = 72.8 bits (177), Expect = 6e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 283 CLCARSQADPKESHMAAVKRIFRYLKGLPELGVWYPKN 170 CLCAR QA+PKESH+AAVKRIFRYLKG P LG+WYPK+ Sbjct: 203 CLCARYQANPKESHLAAVKRIFRYLKGTPNLGLWYPKD 240 >emb|CAN83181.1| hypothetical protein VITISV_013310 [Vitis vinifera] Length = 455 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/44 (65%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = -2 Query: 283 CLCARSQADPKESHMAAVKRIFRYLKGLPELGVWYPK--NFSLV 158 CLCAR Q+ PKESH++AVKRI RYLKG+ ++G+WYPK NF L+ Sbjct: 260 CLCARFQSCPKESHLSAVKRILRYLKGIMDIGLWYPKGDNFELI 303 >emb|CAN69205.1| hypothetical protein VITISV_036606 [Vitis vinifera] Length = 371 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -2 Query: 283 CLCARSQADPKESHMAAVKRIFRYLKGLPELGVWYPK--NFSLV 158 CLCAR Q+ PKESH++AVKRI RYLKG ++G+WYPK NF L+ Sbjct: 91 CLCARFQSCPKESHLSAVKRILRYLKGTMDMGLWYPKSDNFELI 134 >emb|CAN63212.1| hypothetical protein VITISV_002844 [Vitis vinifera] Length = 900 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -2 Query: 283 CLCARSQADPKESHMAAVKRIFRYLKGLPELGVWYPK--NFSLV 158 CLCAR Q+ PKESH++AVKRI RYLKG ++G+WYPK NF L+ Sbjct: 271 CLCARFQSCPKESHLSAVKRILRYLKGTMDIGLWYPKGDNFELI 314 >emb|CAN66523.1| hypothetical protein VITISV_014781 [Vitis vinifera] Length = 334 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -2 Query: 283 CLCARSQADPKESHMAAVKRIFRYLKGLPELGVWYPK--NFSLV 158 CLCAR Q+ PKESH++AVKRI RYLKG ++G+WYPK NF L+ Sbjct: 139 CLCARFQSCPKESHLSAVKRILRYLKGTMDIGLWYPKGDNFELI 182