BLASTX nr result
ID: Atractylodes21_contig00015655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015655 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597763.1| BY-inesin-like protein [Medicago truncatula]... 62 5e-08 ref|XP_002882975.1| kinesin motor family protein [Arabidopsis ly... 62 6e-08 ref|XP_002298217.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|NP_566534.1| kinesin family member 2/24 [Arabidopsis thalian... 62 6e-08 ref|XP_002516057.1| kif4, putative [Ricinus communis] gi|2235449... 61 1e-07 >ref|XP_003597763.1| BY-inesin-like protein [Medicago truncatula] gi|355486811|gb|AES68014.1| BY-inesin-like protein [Medicago truncatula] Length = 700 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LSQKAAAILELQNRLAHFQKRLREHNVLVSSSGF 104 LSQKAA I++LQNRLAHFQKRL+EHNVLVSSSG+ Sbjct: 667 LSQKAAGIMQLQNRLAHFQKRLKEHNVLVSSSGY 700 >ref|XP_002882975.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata] gi|297328815|gb|EFH59234.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata] Length = 688 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LSQKAAAILELQNRLAHFQKRLREHNVLVSSSGF 104 LSQKAA IL+LQNRLAHFQKRLREHNVLVS++G+ Sbjct: 655 LSQKAAGILQLQNRLAHFQKRLREHNVLVSTTGY 688 >ref|XP_002298217.1| predicted protein [Populus trichocarpa] gi|222845475|gb|EEE83022.1| predicted protein [Populus trichocarpa] Length = 721 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 LSQKAAAILELQNRLAHFQKRLREHNVLVSSSG 101 LSQKAA IL+LQNRLAHFQKRL+EHNVLVSSSG Sbjct: 688 LSQKAAGILQLQNRLAHFQKRLKEHNVLVSSSG 720 >ref|NP_566534.1| kinesin family member 2/24 [Arabidopsis thaliana] gi|15450501|gb|AAK96543.1| AT3g16060/MSL1_10 [Arabidopsis thaliana] gi|16974325|gb|AAL31147.1| AT3g16060/MSL1_10 [Arabidopsis thaliana] gi|332642246|gb|AEE75767.1| kinesin family member 2/24 [Arabidopsis thaliana] Length = 684 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LSQKAAAILELQNRLAHFQKRLREHNVLVSSSGF 104 LSQKAA IL+LQNRLAHFQKRLREHNVLVS++G+ Sbjct: 651 LSQKAAGILQLQNRLAHFQKRLREHNVLVSTTGY 684 >ref|XP_002516057.1| kif4, putative [Ricinus communis] gi|223544962|gb|EEF46477.1| kif4, putative [Ricinus communis] Length = 712 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 3 LSQKAAAILELQNRLAHFQKRLREHNVLVSSSGF 104 LSQKAA IL+LQNRLAHFQKRL+EHNVL+SS G+ Sbjct: 679 LSQKAAGILQLQNRLAHFQKRLKEHNVLISSGGY 712