BLASTX nr result
ID: Atractylodes21_contig00015293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015293 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531776.1| transporter, putative [Ricinus communis] gi|... 81 8e-14 ref|XP_002330575.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|XP_002268040.1| PREDICTED: uncharacterized protein LOC100263... 72 4e-11 ref|NP_175965.2| sec.4-like phosphatidylinositol transfer protei... 70 1e-10 ref|NP_849815.1| sec.4-like phosphatidylinositol transfer protei... 70 1e-10 >ref|XP_002531776.1| transporter, putative [Ricinus communis] gi|223528612|gb|EEF30632.1| transporter, putative [Ricinus communis] Length = 618 Score = 81.3 bits (199), Expect = 8e-14 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 135 MSGLEGLEAFDEIRERRSDFENSEDERRRSKIGSLKKKAINASNK 1 MSGLEG+ A DEIRERRSDFENSEDERRRSKIG+LKKKA+NASNK Sbjct: 1 MSGLEGIGASDEIRERRSDFENSEDERRRSKIGNLKKKALNASNK 45 >ref|XP_002330575.1| predicted protein [Populus trichocarpa] gi|222872133|gb|EEF09264.1| predicted protein [Populus trichocarpa] Length = 620 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 135 MSGLEGLEAFDEIRERRSDFENSEDERRRSKIGSLKKKAINASNK 1 MS +EG+ DE RERRSDFENSEDERRRSKIG+LKKKA+NASNK Sbjct: 1 MSSVEGIVVNDEYRERRSDFENSEDERRRSKIGNLKKKALNASNK 45 >ref|XP_002268040.1| PREDICTED: uncharacterized protein LOC100263435 [Vitis vinifera] gi|296089980|emb|CBI39799.3| unnamed protein product [Vitis vinifera] Length = 621 Score = 72.4 bits (176), Expect = 4e-11 Identities = 40/46 (86%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -3 Query: 135 MSGLE-GLEAFDEIRERRSDFENSEDERRRSKIGSLKKKAINASNK 1 MSGLE GL A DEIRERRSD ENSEDERRRSKI LKKKAINASNK Sbjct: 1 MSGLEEGLGAQDEIRERRSDLENSEDERRRSKIAHLKKKAINASNK 46 >ref|NP_175965.2| sec.4-like phosphatidylinositol transfer protein [Arabidopsis thaliana] gi|332195164|gb|AEE33285.1| sec.4-like phosphatidylinositol transfer protein [Arabidopsis thaliana] Length = 621 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 135 MSGLEGLEAFDEIRERRSDFENSEDERRRSKIGSLKKKAINASNK 1 MSG+E + DE RERRSDFE SEDERRRSKIG+LKKKAINAS K Sbjct: 1 MSGVEEISTLDEFRERRSDFEISEDERRRSKIGNLKKKAINASTK 45 >ref|NP_849815.1| sec.4-like phosphatidylinositol transfer protein [Arabidopsis thaliana] gi|30695993|ref|NP_849816.1| sec.4-like phosphatidylinositol transfer protein [Arabidopsis thaliana] gi|63003750|gb|AAY25404.1| At1g55690 [Arabidopsis thaliana] gi|209414534|gb|ACI46507.1| At1g55690 [Arabidopsis thaliana] gi|332195163|gb|AEE33284.1| sec.4-like phosphatidylinositol transfer protein [Arabidopsis thaliana] gi|332195165|gb|AEE33286.1| sec.4-like phosphatidylinositol transfer protein [Arabidopsis thaliana] Length = 625 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 135 MSGLEGLEAFDEIRERRSDFENSEDERRRSKIGSLKKKAINASNK 1 MSG+E + DE RERRSDFE SEDERRRSKIG+LKKKAINAS K Sbjct: 1 MSGVEEISTLDEFRERRSDFEISEDERRRSKIGNLKKKAINASTK 45