BLASTX nr result
ID: Atractylodes21_contig00013585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00013585 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267865.2| PREDICTED: glutamate synthase 1 [NADH], chlo... 79 5e-13 ref|XP_002513554.1| glutamate synthase, putative [Ricinus commun... 78 7e-13 ref|XP_002321436.1| predicted protein [Populus trichocarpa] gi|2... 78 9e-13 ref|XP_002332732.1| predicted protein [Populus trichocarpa] gi|2... 78 9e-13 ref|NP_200158.2| glutamate synthase 1 [NADH] [Arabidopsis thalia... 77 1e-12 >ref|XP_002267865.2| PREDICTED: glutamate synthase 1 [NADH], chloroplastic-like [Vitis vinifera] gi|302144040|emb|CBI23145.3| unnamed protein product [Vitis vinifera] Length = 2216 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 3 QQHQRHTSSQLAKEVLADFDRLLPKFIKVFPRDYKRVLAIMKAQ 134 QQHQRHT+SQLAKE+LADFD LLPKFIKVFPRDYKRV+ MK + Sbjct: 1598 QQHQRHTNSQLAKEILADFDNLLPKFIKVFPRDYKRVIESMKQE 1641 >ref|XP_002513554.1| glutamate synthase, putative [Ricinus communis] gi|223547462|gb|EEF48957.1| glutamate synthase, putative [Ricinus communis] Length = 2215 Score = 78.2 bits (191), Expect = 7e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 3 QQHQRHTSSQLAKEVLADFDRLLPKFIKVFPRDYKRVLAIMKAQ 134 QQHQRHT+SQLA+EVLADF+ LLPKFIKVFPRDYKRVLA MK + Sbjct: 1595 QQHQRHTNSQLAREVLADFETLLPKFIKVFPRDYKRVLAKMKQE 1638 >ref|XP_002321436.1| predicted protein [Populus trichocarpa] gi|222868432|gb|EEF05563.1| predicted protein [Populus trichocarpa] Length = 2221 Score = 77.8 bits (190), Expect = 9e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +3 Query: 3 QQHQRHTSSQLAKEVLADFDRLLPKFIKVFPRDYKRVLAIMKAQN 137 QQHQRHT+S LA+EVLADFD LLPKFIKVFPRDYKRVLA MK ++ Sbjct: 1600 QQHQRHTNSLLAREVLADFDNLLPKFIKVFPRDYKRVLANMKEES 1644 >ref|XP_002332732.1| predicted protein [Populus trichocarpa] gi|222837542|gb|EEE75907.1| predicted protein [Populus trichocarpa] Length = 2230 Score = 77.8 bits (190), Expect = 9e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +3 Query: 3 QQHQRHTSSQLAKEVLADFDRLLPKFIKVFPRDYKRVLAIMKAQN 137 QQHQRHT+S LA+EVLADFD LLPKFIKVFPRDYKRVLA MK ++ Sbjct: 1602 QQHQRHTNSLLAREVLADFDNLLPKFIKVFPRDYKRVLANMKEES 1646 >ref|NP_200158.2| glutamate synthase 1 [NADH] [Arabidopsis thaliana] gi|334188362|ref|NP_001190529.1| glutamate synthase 1 [NADH] [Arabidopsis thaliana] gi|334188364|ref|NP_001190530.1| glutamate synthase 1 [NADH] [Arabidopsis thaliana] gi|300680981|sp|Q9LV03.2|GLUT1_ARATH RecName: Full=Glutamate synthase 1 [NADH], chloroplastic; AltName: Full=NADH-dependent glutamate synthase 1; Short=NADH-GOGAT 1; Flags: Precursor gi|332008975|gb|AED96358.1| glutamate synthase 1 [NADH] [Arabidopsis thaliana] gi|332008976|gb|AED96359.1| glutamate synthase 1 [NADH] [Arabidopsis thaliana] gi|332008977|gb|AED96360.1| glutamate synthase 1 [NADH] [Arabidopsis thaliana] Length = 2208 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 3 QQHQRHTSSQLAKEVLADFDRLLPKFIKVFPRDYKRVLAIMK 128 QQHQRHT+SQLA+EVLADF+ LLPKFIKVFPRDYKRVL+ MK Sbjct: 1596 QQHQRHTNSQLAQEVLADFENLLPKFIKVFPRDYKRVLSAMK 1637