BLASTX nr result
ID: Atractylodes21_contig00013297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00013297 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330776.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 ref|XP_002523753.1| transferase, transferring glycosyl groups, p... 85 7e-15 ref|NP_565236.1| nucleotide-diphospho-sugar transferase [Arabido... 84 2e-14 ref|XP_003588614.1| Exostosin-1a [Medicago truncatula] gi|355477... 84 2e-14 ref|NP_001077854.1| nucleotide-diphospho-sugar transferase [Arab... 84 2e-14 >ref|XP_002330776.1| predicted protein [Populus trichocarpa] gi|222872578|gb|EEF09709.1| predicted protein [Populus trichocarpa] Length = 334 Score = 86.3 bits (212), Expect = 3e-15 Identities = 39/58 (67%), Positives = 45/58 (77%) Frame = +2 Query: 5 VGLSSXXXXXXXXXXDCIREFHRVLGKMPLRYGYGKMVDSIGEQGLCEKGGKLVFCDQ 178 VGLSS DC+REFH+VLG+MPLRY YGK+V+S+GEQG C KGGKLVFCDQ Sbjct: 274 VGLSSRRREHRKRRGDCLREFHKVLGRMPLRYSYGKVVNSVGEQGRCLKGGKLVFCDQ 331 >ref|XP_002523753.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223537057|gb|EEF38693.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 349 Score = 85.1 bits (209), Expect = 7e-15 Identities = 36/59 (61%), Positives = 47/59 (79%) Frame = +2 Query: 2 SVGLSSXXXXXXXXXXDCIREFHRVLGKMPLRYGYGKMVDSIGEQGLCEKGGKLVFCDQ 178 +VGLSS +CIREFH++LG+MPLRY YGK+++S+GEQGLC KGGKL+FCD+ Sbjct: 289 AVGLSSRVGEHRKRRGECIREFHKLLGRMPLRYSYGKVINSVGEQGLCMKGGKLIFCDR 347 >ref|NP_565236.1| nucleotide-diphospho-sugar transferase [Arabidopsis thaliana] gi|12324977|gb|AAG52433.1|AC018848_4 hypothetical protein; 16105-17094 [Arabidopsis thaliana] gi|89000939|gb|ABD59059.1| At1g80290 [Arabidopsis thaliana] gi|222424350|dbj|BAH20131.1| AT1G80290 [Arabidopsis thaliana] gi|332198262|gb|AEE36383.1| nucleotide-diphospho-sugar transferase [Arabidopsis thaliana] Length = 329 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = +2 Query: 5 VGLSSXXXXXXXXXXDCIREFHRVLGKMPLRYGYGKMVDSIGEQGLCEKGGKLVFCDQ 178 VGLSS +CIREFHRV+GKMPL Y YGK+V+S+GEQGLC K GKLVFCD+ Sbjct: 271 VGLSSRRVEHRKRRGNCIREFHRVMGKMPLMYSYGKVVNSVGEQGLCRKAGKLVFCDR 328 >ref|XP_003588614.1| Exostosin-1a [Medicago truncatula] gi|355477662|gb|AES58865.1| Exostosin-1a [Medicago truncatula] Length = 292 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = +2 Query: 2 SVGLSSXXXXXXXXXXDCIREFHRVLGKMPLRYGYGKMVDSIGEQGLCEKGGKLVFCDQ 178 S GLS CI EFHR+LG+MPLRY YGK+VDSIGEQGLC KGG+LVFCDQ Sbjct: 234 SSGLSGRKGEHRKNRGWCITEFHRILGRMPLRYSYGKVVDSIGEQGLCRKGGRLVFCDQ 292 >ref|NP_001077854.1| nucleotide-diphospho-sugar transferase [Arabidopsis thaliana] gi|332198263|gb|AEE36384.1| nucleotide-diphospho-sugar transferase [Arabidopsis thaliana] Length = 337 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = +2 Query: 5 VGLSSXXXXXXXXXXDCIREFHRVLGKMPLRYGYGKMVDSIGEQGLCEKGGKLVFCDQ 178 VGLSS +CIREFHRV+GKMPL Y YGK+V+S+GEQGLC K GKLVFCD+ Sbjct: 279 VGLSSRRVEHRKRRGNCIREFHRVMGKMPLMYSYGKVVNSVGEQGLCRKAGKLVFCDR 336