BLASTX nr result
ID: Atractylodes21_contig00013087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00013087 (680 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140546.1| PREDICTED: serine/threonine-protein kinase P... 61 2e-07 ref|XP_002514864.1| receptor serine-threonine protein kinase, pu... 57 4e-06 >ref|XP_004140546.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis sativus] gi|449487387|ref|XP_004157601.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Cucumis sativus] Length = 469 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -3 Query: 123 MGCFSCFDSREEEKSNPQKVGADRPQLHPSAPSNISRLPSG 1 MGCF CFDSREEEK NP+K D Q HP P NI++LPSG Sbjct: 1 MGCFPCFDSREEEKLNPEKESDDGKQDHPMVPPNIAKLPSG 41 >ref|XP_002514864.1| receptor serine-threonine protein kinase, putative [Ricinus communis] gi|223545915|gb|EEF47418.1| receptor serine-threonine protein kinase, putative [Ricinus communis] Length = 461 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -3 Query: 123 MGCFSCFDSREEEKSNPQKVGADRPQLHPSAPSNISRLPSG 1 MGCF CFDSREEE NPQK DR Q P+ SNIS+L SG Sbjct: 1 MGCFPCFDSREEETLNPQKESDDRKQSLPTESSNISKLSSG 41