BLASTX nr result
ID: Atractylodes21_contig00012996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012996 (971 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322111.1| predicted protein [Populus trichocarpa] gi|2... 63 1e-07 ref|XP_003529680.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 2e-07 emb|CBI38032.3| unnamed protein product [Vitis vinifera] 62 2e-07 ref|XP_003551050.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 3e-07 ref|XP_003631587.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 60 8e-07 >ref|XP_002322111.1| predicted protein [Populus trichocarpa] gi|222869107|gb|EEF06238.1| predicted protein [Populus trichocarpa] Length = 710 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -1 Query: 206 MKRSTDDIGEKLQAKKPVFLTKAEREQLALKRRQDEVDEEKRRSEQRLLQ 57 MKRS DDIG KPVFLTKA+REQLAL+RRQ+E++++K+R + L Q Sbjct: 1 MKRSFDDIGVSKTQSKPVFLTKAQREQLALQRRQEEIEQQKKRQQLLLSQ 50 >ref|XP_003529680.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like [Glycine max] Length = 701 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -1 Query: 206 MKRSTDDIGEKLQAKKPVFLTKAEREQLALKRRQDEVDEEKRRSEQRL 63 MKRS DD+ + KPVFLTKA+REQLAL+RR ++V ++KRR EQ L Sbjct: 1 MKRSNDDVAAPVSTAKPVFLTKAQREQLALQRRHEDVADQKRRQEQLL 48 >emb|CBI38032.3| unnamed protein product [Vitis vinifera] Length = 797 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 6/58 (10%) Frame = -1 Query: 212 SAMKRSTDD------IGEKLQAKKPVFLTKAEREQLALKRRQDEVDEEKRRSEQRLLQ 57 +AMKRS ++ + KKPVFLTKA+REQLAL+RR +E+ E+KRR+EQ+LLQ Sbjct: 45 AAMKRSIEEDISTTIVSAATNMKKPVFLTKAQREQLALQRRHEEIAEQKRRAEQQLLQ 102 >ref|XP_003551050.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like isoform 1 [Glycine max] gi|356565649|ref|XP_003551051.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like isoform 2 [Glycine max] Length = 706 Score = 61.6 bits (148), Expect = 3e-07 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -1 Query: 206 MKRSTDDIGEKLQAK--KPVFLTKAEREQLALKRRQDEVDEEKRRSEQRL 63 MKRS DD+ + A KPVFLTKA+REQLAL+RRQ+EV ++KRR EQ L Sbjct: 1 MKRSNDDVAAPVPASTSKPVFLTKAQREQLALQRRQEEVADQKRRQEQLL 50 >ref|XP_003631587.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like [Vitis vinifera] Length = 712 Score = 60.1 bits (144), Expect = 8e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -1 Query: 197 STDDIGEKLQAKKPVFLTKAEREQLALKRRQDEVDEEKRRSEQRLLQ 57 ST + KKPVFLTKA+REQLAL+RR +E+ E+KRR+EQ+LLQ Sbjct: 10 STTIVSAATNMKKPVFLTKAQREQLALQRRHEEIAEQKRRAEQQLLQ 56