BLASTX nr result
ID: Atractylodes21_contig00012974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012974 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor... 55 1e-11 emb|CBI21439.3| unnamed protein product [Vitis vinifera] 55 1e-11 emb|CBI32432.3| unnamed protein product [Vitis vinifera] 52 3e-11 ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor... 52 3e-11 ref|XP_002523560.1| conserved hypothetical protein [Ricinus comm... 50 1e-10 >ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Vitis vinifera] Length = 227 Score = 55.5 bits (132), Expect(2) = 1e-11 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 229 RFAEKYNYDFVNDVPMDGRYQWVRLKP 149 RF+EKYNYD V DVPM+GRY+WVRLKP Sbjct: 201 RFSEKYNYDIVKDVPMEGRYEWVRLKP 227 Score = 38.5 bits (88), Expect(2) = 1e-11 Identities = 22/59 (37%), Positives = 35/59 (59%) Frame = -1 Query: 482 REASSSSEICLYSEEMESSSTLKKKPAAPQEATSRRKPATASNIPTAAEIEEFFSVVEK 306 RE + SSE+ S+++ES+ A P EA R + +T +P+ +E+EEFF+ EK Sbjct: 146 RETTPSSELRAESDDLEST-------ARPSEANYRHR-STVEKMPSESELEEFFAAAEK 196 >emb|CBI21439.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 55.5 bits (132), Expect(2) = 1e-11 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 229 RFAEKYNYDFVNDVPMDGRYQWVRLKP 149 RF+EKYNYD V DVPM+GRY+WVRLKP Sbjct: 186 RFSEKYNYDIVKDVPMEGRYEWVRLKP 212 Score = 38.5 bits (88), Expect(2) = 1e-11 Identities = 22/59 (37%), Positives = 35/59 (59%) Frame = -1 Query: 482 REASSSSEICLYSEEMESSSTLKKKPAAPQEATSRRKPATASNIPTAAEIEEFFSVVEK 306 RE + SSE+ S+++ES+ A P EA R + +T +P+ +E+EEFF+ EK Sbjct: 131 RETTPSSELRAESDDLEST-------ARPSEANYRHR-STVEKMPSESELEEFFAAAEK 181 >emb|CBI32432.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 52.0 bits (123), Expect(2) = 3e-11 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 229 RFAEKYNYDFVNDVPMDGRYQWVRLK 152 RFAEKYNYD V D PM+GRYQWVRL+ Sbjct: 208 RFAEKYNYDIVKDAPMEGRYQWVRLE 233 Score = 40.8 bits (94), Expect(2) = 3e-11 Identities = 25/59 (42%), Positives = 32/59 (54%) Frame = -1 Query: 482 REASSSSEICLYSEEMESSSTLKKKPAAPQEATSRRKPATASNIPTAAEIEEFFSVVEK 306 RE + SE LY++ E ST K A P R+ +TA +P+ EIEEFFS EK Sbjct: 153 RETTPVSE--LYADSAEMESTAKTTAAKP------RRKSTAGKMPSTVEIEEFFSAAEK 203 >ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Vitis vinifera] Length = 203 Score = 52.0 bits (123), Expect(2) = 3e-11 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 229 RFAEKYNYDFVNDVPMDGRYQWVRLK 152 RFAEKYNYD V D PM+GRYQWVRL+ Sbjct: 177 RFAEKYNYDIVKDAPMEGRYQWVRLE 202 Score = 40.8 bits (94), Expect(2) = 3e-11 Identities = 25/59 (42%), Positives = 32/59 (54%) Frame = -1 Query: 482 REASSSSEICLYSEEMESSSTLKKKPAAPQEATSRRKPATASNIPTAAEIEEFFSVVEK 306 RE + SE LY++ E ST K A P R+ +TA +P+ EIEEFFS EK Sbjct: 122 RETTPVSE--LYADSAEMESTAKTTAAKP------RRKSTAGKMPSTVEIEEFFSAAEK 172 >ref|XP_002523560.1| conserved hypothetical protein [Ricinus communis] gi|223537122|gb|EEF38755.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 50.4 bits (119), Expect(2) = 1e-10 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = -2 Query: 229 RFAEKYNYDFVNDVPMDGRYQWVRLKP 149 RFA+KYNYD V D P+ GRY+WVRLKP Sbjct: 193 RFADKYNYDVVKDEPLKGRYEWVRLKP 219 Score = 40.4 bits (93), Expect(2) = 1e-10 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = -1 Query: 482 REASSSSEICLYSEEMESSSTLKKKPAAPQEATSRRKPA-TASNIPTAAEIEEFFSVVEK 306 RE++ SSE+ EE+ +P+A EA SRRKP+ T +PT E++EFF+ E+ Sbjct: 133 RESTPSSEV---GEELSDELDSTARPSA-MEANSRRKPSLTVEKMPTETELDEFFAEAER 188