BLASTX nr result
ID: Atractylodes21_contig00012847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012847 (461 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271877.1| PREDICTED: UPF0392 protein RCOM_0530710-like... 67 2e-09 ref|XP_002312696.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 gb|ABK95005.1| unknown [Populus trichocarpa] 63 2e-08 emb|CBI32066.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002520193.1| ubiquitin-protein ligase, putative [Ricinus ... 61 8e-08 >ref|XP_002271877.1| PREDICTED: UPF0392 protein RCOM_0530710-like [Vitis vinifera] Length = 601 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 4 LQFCEVWDTGLRDFVLANLADISTGVLPWDRSL 102 LQFCEVWDTGLRDFVLANLAD +TG+LPW+RSL Sbjct: 568 LQFCEVWDTGLRDFVLANLADPTTGLLPWERSL 600 >ref|XP_002312696.1| predicted protein [Populus trichocarpa] gi|222852516|gb|EEE90063.1| predicted protein [Populus trichocarpa] Length = 601 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 1 RLQFCEVWDTGLRDFVLANLADISTGVLPWDRSL 102 RLQFCEVWDTGL+DFV+AN AD ++G LPW+RSL Sbjct: 567 RLQFCEVWDTGLKDFVMANFADSASGFLPWERSL 600 >gb|ABK95005.1| unknown [Populus trichocarpa] Length = 601 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 1 RLQFCEVWDTGLRDFVLANLADISTGVLPWDRSL 102 RLQFCEVWDTGL+DFV+AN AD ++G LPW+RSL Sbjct: 567 RLQFCEVWDTGLKDFVMANFADSASGFLPWERSL 600 >emb|CBI32066.3| unnamed protein product [Vitis vinifera] Length = 521 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 4 LQFCEVWDTGLRDFVLANLADISTGVLPWD 93 LQFCEVWDTGLRDFVLANLAD +TG+LPW+ Sbjct: 483 LQFCEVWDTGLRDFVLANLADPTTGLLPWE 512 >ref|XP_002520193.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|325530317|sp|B9S2H4.1|Y232_RICCO RecName: Full=UPF0392 protein RCOM_0530710 gi|223540685|gb|EEF42248.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 578 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 RLQFCEVWDTGLRDFVLANLADISTGVLPWDRS 99 RL+FCEVWDTGL+DFVLAN AD ++G LPW+RS Sbjct: 544 RLRFCEVWDTGLKDFVLANFADTASGYLPWERS 576