BLASTX nr result
ID: Atractylodes21_contig00012820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012820 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC53941.1| H2A histone [Nicotiana tabacum] 74 9e-12 ref|XP_002512417.1| histone h2a, putative [Ricinus communis] gi|... 72 6e-11 sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Ful... 71 8e-11 dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow... 71 8e-11 ref|XP_003569004.1| PREDICTED: probable histone H2A.6-like [Brac... 71 8e-11 >dbj|BAC53941.1| H2A histone [Nicotiana tabacum] Length = 148 Score = 74.3 bits (181), Expect = 9e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 161 SVTKSVKAGLQFPVGRIARFLKKGRYAQRTGSGAPIY 271 SVTKSVKAGLQFPVGRIARFLKKGRYAQR GSGAPIY Sbjct: 23 SVTKSVKAGLQFPVGRIARFLKKGRYAQRVGSGAPIY 59 >ref|XP_002512417.1| histone h2a, putative [Ricinus communis] gi|223548378|gb|EEF49869.1| histone h2a, putative [Ricinus communis] Length = 146 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 161 SVTKSVKAGLQFPVGRIARFLKKGRYAQRTGSGAPIY 271 SV+KSVKAGLQFPVGRIARFLKKGRYAQR GSGAP+Y Sbjct: 21 SVSKSVKAGLQFPVGRIARFLKKGRYAQRFGSGAPVY 57 >sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Full=LeH2A-1 gi|355477218|gb|AES12482.1| putative histone 2A protein [Solanum lycopersicum] Length = 146 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 161 SVTKSVKAGLQFPVGRIARFLKKGRYAQRTGSGAPIY 271 SVTKS+KAGLQFPVGRI R+LKKGRYAQR GSGAPIY Sbjct: 21 SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIY 57 >dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00001] gi|374428674|dbj|BAL49716.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00002] gi|374428678|dbj|BAL49719.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00003] gi|374428682|dbj|BAL49722.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00004] gi|374428686|dbj|BAL49725.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00005] gi|374428690|dbj|BAL49728.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00006] gi|374428694|dbj|BAL49731.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00007] gi|374428698|dbj|BAL49734.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00008] gi|374428702|dbj|BAL49737.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00009] gi|374428706|dbj|BAL49740.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00010] gi|374428710|dbj|BAL49743.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00011] gi|374428714|dbj|BAL49746.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00012] gi|374428718|dbj|BAL49749.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00013] gi|374428722|dbj|BAL49752.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00014] gi|374428726|dbj|BAL49755.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00015] gi|374428730|dbj|BAL49758.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00016] gi|374428734|dbj|BAL49761.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00017] gi|374428738|dbj|BAL49764.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00018] gi|374428742|dbj|BAL49767.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00019] gi|374428748|dbj|BAL49770.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00020] gi|374428752|dbj|BAL49773.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00021] gi|374428756|dbj|BAL49776.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00022] gi|374428760|dbj|BAL49779.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00023] gi|374428764|dbj|BAL49782.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00024] gi|374428768|dbj|BAL49785.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00025] gi|374428772|dbj|BAL49788.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00026] gi|374428776|dbj|BAL49791.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00027] gi|374428780|dbj|BAL49794.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00028] gi|374428784|dbj|BAL49797.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00029] gi|374428788|dbj|BAL49800.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00030] gi|374428792|dbj|BAL49803.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00031] gi|374428796|dbj|BAL49806.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00032] Length = 387 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 161 SVTKSVKAGLQFPVGRIARFLKKGRYAQRTGSGAPIY 271 SVTKS+KAGLQFPVGRI R+LKKGRYAQR GSGAPIY Sbjct: 21 SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIY 57 >ref|XP_003569004.1| PREDICTED: probable histone H2A.6-like [Brachypodium distachyon] Length = 159 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 161 SVTKSVKAGLQFPVGRIARFLKKGRYAQRTGSGAPIY 271 SVT+SVKAGLQFPVGRI RFLKKGRYAQR GSGAP+Y Sbjct: 24 SVTRSVKAGLQFPVGRIGRFLKKGRYAQRVGSGAPVY 60